(data stored in ACNUC7421 zone)

EMBL: CP001389.PE584

CP001389.PE584       Location/Qualifiers
FT   CDS_pept        complement(652137..652898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05950"
FT                   /product="putative beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05950"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24388"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI40"
FT                   /protein_id="ACP24388.1"
FT                   /translation="MKMHFLAGGRLRMRRSVFVPGVGKEETIELPVHATLIRHRQGNVL
FT                   FDTGCNPEAATDPEARWGGLAKVMTPIFDPEQTVVRQLAALGLEAGDIDVVICSHLHPD
FT                   HCGCNQYFGRATILCHEAEVAAAKTDAAENQGYLKPEWDQPQGFQTFGAEHDVFGDGHI
FT                   VLLPMPGHTPGMTVAHVSLRDSGTFVLASDAAPLQANIDAGVAPRNTWNMELAAAALAR
FT                   LKAFRDKGATIVSGHDEAQWQALRKGGEFYE"
     atgaagatgc attttctcgc cggcggccga ctgcgcatgc gccggtccgt cttcgttccc        60
     ggcgtgggga aggaggagac gatcgaactg cctgtccacg caaccctgat acggcaccgc       120
     caagggaacg tgcttttcga caccggctgc aaccctgagg ccgccaccga tccggaagcg       180
     cgctggggcg ggttggccaa ggtgatgacg ccgatatttg atccggagca gacggttgtc       240
     cggcaactgg cagcgctcgg ccttgaggct ggcgacatcg acgtcgtgat ctgctcgcac       300
     ctgcatcccg accattgcgg gtgcaaccag tattttggcc gcgcgacgat cctgtgccat       360
     gaggcggaag tcgcggcggc gaaaaccgac gccgccgaga accagggcta tctgaaaccg       420
     gaatgggacc agccgcaagg ctttcagacc ttcggcgcgg agcacgacgt cttcggcgac       480
     gggcacatcg tcctccttcc catgcccggc catacgcccg gcatgaccgt cgcgcatgta       540
     tcgctgcggg acagcggcac cttcgttctc gcctccgacg ccgcgcccct tcaggccaat       600
     atcgatgcag gcgtcgcgcc gcggaacacc tggaacatgg agctcgccgc ggcggcgctc       660
     gcgcgcttga aggccttccg ggacaagggc gcgaccatcg tctccggaca tgacgaggcg       720
     cagtggcagg ccctgcggaa gggcggggag ttttacgaat ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page