(data stored in ACNUC7421 zone)

EMBL: CP001389.PE586

CP001389.PE586       Location/Qualifiers
FT   CDS_pept        complement(653373..654434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05970"
FT                   /product="carbon monoxide dehydrogenase medium chain"
FT                   /EC_number="1.2.99.2"
FT                   /note="COdehydrogenase subunit M; CO-DH M"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24390"
FT                   /db_xref="GOA:C3MI42"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI42"
FT                   /protein_id="ACP24390.1"
FT                   /translation="MLDNPILSLIMQVNFETRHGIGETRRSRDDKAFRDISEPSGAHGP
FT                   TMPESAFPIDGGEMKPAPFEYLAATSAAEAAEALAAANGDGKIIAGGQSLMPMINFRLV
FT                   KPTILIDINRIAGLDRIEKHGERLRIGATVRHRMTATDALVHRHIPILHDAMHHVAHLT
FT                   VRNRGTFCGSVCHADPAAEMPVMTLLLDGTITALSIRGERQIAASDFFVGSLMTALEPD
FT                   EFVTSIDIDTLPPETGWGFEEFSRRHGDFALACVATTLRIVDGVAGDVRFGMMGVGETP
FT                   LRLPDIETLVEGQAISEMLLQDVSETLKGLLHPNTDIHASADYRLHLAGALARRALRDA
FT                   WTRATLRKDGADA"
     ttgcttgaca atcctatttt aagtctaata atgcaagtta attttgaaac gcgccatggg        60
     attggcgaga ctaggaggag ccgcgatgac aaggctttcc gcgatatatc ggaaccctct       120
     ggcgcccacg gccctacgat gccggaaagc gcctttccta tcgacggcgg cgaaatgaaa       180
     ccggccccct tcgaatacct cgccgcgaca tcggcagccg aggctgccga ggccctcgcc       240
     gctgcgaacg gcgacggcaa gataatcgcg ggcggccaga gccttatgcc gatgatcaac       300
     ttccgtctgg tgaagcccac gatcctgatc gacatcaacc gcattgccgg cctcgatcgc       360
     atcgaaaagc acggtgaacg gctgcgcatc ggggccacgg tacggcaccg catgaccgcg       420
     acggatgcac tcgtgcaccg gcacatcccg atcctgcacg acgccatgca tcacgtggcg       480
     catctgacgg tgcgcaatcg cggtaccttc tgcggcagcg tctgtcatgc ggacccggca       540
     gcggaaatgc cggtgatgac gcttctcctc gacgggacga ttacggccct ctcgatccgg       600
     ggcgagcggc agattgccgc ctcggacttc ttcgtcggct cgctgatgac agcgctcgaa       660
     ccggacgagt tcgtcacctc gatcgatatc gacacgctgc cacccgagac gggctggggc       720
     ttcgaggaat tctccaggcg ccacggcgat tttgccctcg cctgcgtggc aaccacgctg       780
     cgcatcgtcg atggcgtcgc aggcgacgtc cgtttcggca tgatgggcgt cggcgagacg       840
     ccgttgcgcc tgccggacat cgaaacgctc gtcgagggcc aggcgatttc ggagatgctg       900
     ttgcaggacg tgtcggagac cctgaagggg ctcctccatc ccaacaccga tatccatgcg       960
     tccgccgatt atcgcctgca cctggcgggc gcgcttgcgc ggcgtgcgct acgcgacgca      1020
     tggacgcggg caacccttcg caaggacggc gcagatgcct ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page