(data stored in ACNUC7421 zone)

EMBL: CP001389.PE587

CP001389.PE587       Location/Qualifiers
FT   CDS_pept        654489..655295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05980"
FT                   /product="conserved hypothetical protein with CoxG domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05980"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24391"
FT                   /db_xref="GOA:C3MI43"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI43"
FT                   /protein_id="ACP24391.1"
FT                   /translation="MDMTGQQHIPASKEEVWSALNDADVLKVCIPGCQELTKSSETEMS
FT                   AVAVIKVGPVKARFQGAVTLSDLDPPNGYRITGEGQGGVAGFAKGVAVVRLEAVEDGTV
FT                   LHYTVDAQIGGKLSQLGGRLIDATAKQMSGQFFKRFAEEIRARQGAGQSLATSTEGDAF
FT                   AQPGPVRQSVAVTSSSESASALPRARAVQVSASPTGTSLSLPVLAAVVFAAVVVATWAL
FT                   HGGLLPSLTPPADGPARISPDLASIVQLIMAAAIGYLFGSRGRRAG"
     atggacatga ctggccagca gcacattccc gcgagcaaag aggaggtgtg gagtgccctg        60
     aacgatgccg acgtgctgaa agtctgtatc cctggatgcc aggagctaac gaagtcttcc       120
     gagacagaaa tgtcggctgt cgctgtcatc aaggtcgggc ccgtgaaggc ccggttccag       180
     ggtgccgtga cgctgtcgga cctcgatccg ccgaacggct atcggatcac cggcgaaggg       240
     cagggcggcg tcgccggatt cgcaaaggga gtggcggtcg ttcgtctgga agcggtcgag       300
     gatggaaccg tcctgcatta taccgtcgat gcccagatcg gcggaaagct gtcacagctt       360
     ggcgggaggc ttatcgatgc aaccgcaaaa caaatgtcgg ggcagttttt caagcgattt       420
     gccgaagaga tccgcgcccg ccaaggtgct ggacagtcat tggcgacatc taccgagggt       480
     gatgccttcg cgcaacccgg cccagtaagg cagtcggtcg ccgtcacgtc gtcgagcgaa       540
     agtgcctccg ccttgccgcg tgcgcgcgcc gtgcaagttt ccgcgtcgcc caccggcact       600
     tcgctcagcc tgccggttct tgcggctgtc gtcttcgccg ccgtggtggt ggcgacgtgg       660
     gcgctccatg ggggattgct gccgagcctt acgccgccgg cggacggtcc ggcgcgcatt       720
     tcgccggatt tggcgagcat tgttcagctc atcatggccg cagccatcgg ctacctgttc       780
     gggtctcgtg gaaggcgcgc cggctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page