(data stored in ACNUC7421 zone)

EMBL: CP001389.PE589

CP001389.PE589       Location/Qualifiers
FT   CDS_pept        complement(656337..657224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06000"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06000"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24393"
FT                   /db_xref="GOA:C3MI45"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI45"
FT                   /protein_id="ACP24393.1"
FT                   /translation="MTDIFGVPIAVLLGQLLLGLINGSFYALLSLGLAIIFGMLNVINF
FT                   AHGAFYMLGGFAAWLLLSALGLGYWETLIAAPLMVGALGAVVERLFLKRLYRVDHLYSL
FT                   LLTFGIALMLEGLLRHVYGAAGKPYPIPPSLTGGINLGFMFLPMYRAWVIVASLAVCIA
FT                   TWLAIERTKLGAYLRAATENPGLVQAFGINVPFMLTATYAFCVGLAGFAGALAAPLYQV
FT                   SPGMGSSVIIVVFAVVVIGGMGSIGGAIVTALALGIIEGLTKTFYPAASSIAVFVVMVL
FT                   VILIRPSGLFSREA"
     atgactgata tcttcggggt tcccattgcc gttttactcg ggcaactgct gctcggcttg        60
     atcaacggct ccttctacgc tctcctgagc ctcggcctcg ccatcatctt cggcatgctg       120
     aacgtgatca acttcgccca tggcgccttc tacatgctcg gcggcttcgc cgcctggctg       180
     ctgctgtcgg ccctcggtct cggctattgg gaaacactca tcgccgctcc cctgatggtc       240
     ggggcgctgg gtgccgtcgt ggagcggttg tttctcaagc gcctctacag ggtcgaccac       300
     ctctacagcc tcctcctcac attcggcatc gccttgatgc tcgaagggct cctccggcat       360
     gtctacggcg ccgccggcaa gccttatccg atacccccgt cgctgacggg cggcatcaat       420
     ctcggcttca tgttcctgcc gatgtatcgc gcctgggtga ttgtcgcctc tctcgcagtc       480
     tgcatcgcca catggctggc gattgagcgg accaagctcg gcgcctacct gcgggctgcg       540
     acggaaaatc cgggcctggt ccaggcattc ggaatcaatg tcccgtttat gctgactgcg       600
     acctacgcct tctgcgtggg ccttgccggc tttgcaggcg cactggccgc gccgctctat       660
     caggtcagcc ccggcatggg gtccagcgtc atcatcgtag tcttcgcggt ggtcgtcatc       720
     ggcggcatgg gatcgatcgg cggcgcaatc gtcaccgcct tggcgctggg catcatcgag       780
     gggctgacga agacattcta tcctgcggca tcctccatag cggttttcgt ggtgatggtc       840
     cttgtcattc tcatccggcc atccggcctg ttctcccgcg aggcttga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page