(data stored in ACNUC7421 zone)

EMBL: CP001389.PE599

CP001389.PE599       Location/Qualifiers
FT   CDS_pept        665217..665801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06100"
FT                   /product="adenylate kinase"
FT                   /note="ATP-AMP transphosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24403"
FT                   /db_xref="GOA:C3MI55"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI55"
FT                   /protein_id="ACP24403.1"
FT                   /translation="MVNLVLLGPPGAGKGTQAERLVRDYDLLHISTGDLLRDAIKAQSP
FT                   LGRKAKMAVDEGKLVPDEVVVGLVEERLTDKEPGQGFILDGFPRTIAQAGALERLLESM
FT                   QVPLDHVILFDIPIRLLEERIAKRAEQTRSAGAQPRTDDSPEVLKKRIEEFARATAALS
FT                   PFYEQNGLLRRVDASEDIERVATQIRDFLQP"
     atggtgaacc tcgttcttct agggcctccc ggtgcgggta aaggtacgca ggccgagcga        60
     ctcgtgcggg attatgatct cctgcacatc tccactggtg atctcctacg cgatgcgatc       120
     aaagcccaga gcccgcttgg ccggaaagcg aaaatggcgg tcgatgaggg aaaacttgtt       180
     ccagacgaag tagttgtcgg cctggtggag gagcggctaa ccgataagga gcctggccaa       240
     gggttcattc tggacggatt tccccgaaca attgcacagg caggcgcttt agaacggctg       300
     ctcgagagca tgcaggttcc gctcgatcac gttatcctgt tcgatattcc tatacgcctt       360
     ctcgaggagc gaattgccaa aagagccgaa cagacgcgct ccgcaggcgc gcagccacgt       420
     acggatgaca gcccagaggt cctgaagaaa cgaattgaag agtttgcgcg tgcgacggcg       480
     gcattgtcac cattctacga gcaaaacgga cttcttcgtc gcgtcgatgc atcggaagac       540
     atcgaacgcg ttgcgactca gatccgcgac tttttgcagc cgtag                       585
//

If you have problems or comments...

PBIL Back to PBIL home page