(data stored in ACNUC7421 zone)

EMBL: CP001389.PE6

CP001389.PE6         Location/Qualifiers
FT   CDS_pept        5020..5634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00060"
FT                   /product="glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23810"
FT                   /db_xref="GOA:C3MEI7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI7"
FT                   /protein_id="ACP23810.1"
FT                   /translation="MILYYQTHSPFARKALVFAHEIGLADRLEVVHHETSPTRRNDDVY
FT                   AENPLGKVPVLLRSDAEPIFDSDVICAYFDTLHERRKLIPESGEPRWRALRLQSVAQVL
FT                   AQTGIGLRWEWERRPEQLRWPALAKGYEEKIEATYDWLDTTFLPEEDIDVGQIALATTL
FT                   SWMAFRALPSFRDRSRLTRWFDAFEQRASMVATPLSGETQD"
     gtgatcctct actaccagac ccattccccc ttcgcccgca aggcgctcgt gttcgcccat        60
     gagatcggtc ttgccgatcg cctggaagtc gtccaccacg agacgagccc gacacggcgc       120
     aatgacgacg tctatgccga gaatccgctc ggcaaggttc cggtcctgct gcgcagtgac       180
     gccgagccga tcttcgattc cgatgtcatc tgtgcctatt tcgacacctt gcacgagcga       240
     cgcaagctca ttcccgaaag cggggagccg cggtggcggg cgttgcggct gcaatcggtg       300
     gcacaggtcc ttgcccagac cgggatcggg cttcgctggg agtgggaacg ccgcccggaa       360
     cagttgcgct ggccggcgct tgccaagggc tatgaagaga agatcgaggc gacctacgac       420
     tggctcgaca cgacgtttct tcctgaggaa gacatcgatg tcggccagat cgcactggcc       480
     acgacactgt cgtggatggc ttttcgcgct cttccgtcat ttcgcgaccg gtcgcgcctg       540
     acgcgctggt tcgacgcctt cgagcagcgt gcctcgatgg tcgctacacc gctgtcgggc       600
     gaaacgcagg attga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page