(data stored in ACNUC7421 zone)

EMBL: CP001389.PE60

CP001389.PE60        Location/Qualifiers
FT   CDS_pept        complement(63273..63869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00600"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23864"
FT                   /db_xref="GOA:C3MF27"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF27"
FT                   /protein_id="ACP23864.1"
FT                   /translation="MPLLDEVLAYIKGLWLLIQGNRDGYNWLDISEGGLWRSFAAILWS
FT                   LPAMAVSWASWRLYYLSAMPSGTTVGIGFFLKLLVVDLVSWLLPIVLVAALSRPLGFGP
FT                   LVVPVIVTTNWLSVPLSYAMAIPAALLLLARGGHQLTALLSLIVLVAGVVLLFRLLRTI
FT                   TGNQNLLASALTALYLLPSMMLAQYLQHFFGLIPG"
     atgccgctgc ttgacgaggt tctcgcctat atcaaggggc tctggctgct gatccaggga        60
     aaccgcgacg gttacaactg gttggatatc agtgaaggcg gcctgtggcg ctccttcgcg       120
     gcgatcctct ggtcgctgcc ggccatggcc gtgtcctggg cctcctggcg gctctattat       180
     ctttcggcga tgccgagcgg cacgaccgtc ggcatcggct ttttcctaaa actgctcgtc       240
     gtcgatctcg tcagctggct gctgccgatc gtgctggtcg ccgctctttc gcgccccctc       300
     ggattcggcc cactggtcgt gccggtgatc gtcaccacga actggctctc ggtgcctctt       360
     tcctatgcca tggcaattcc ggctgcgctc ctcctgctgg cccgtggagg ccatcagctc       420
     acggctctct tgtcgctgat cgtccttgtt gccggcgtcg tcctgctgtt ccgattgctg       480
     cgcacgataa ccggcaacca gaacctgctc gcttcggcgc tgacggccct atacctgctg       540
     ccgtcgatga tgctcgcaca atatcttcag cacttcttcg gcctgatccc cggctga          597
//

If you have problems or comments...

PBIL Back to PBIL home page