(data stored in ACNUC7421 zone)

EMBL: CP001389.PE600

CP001389.PE600       Location/Qualifiers
FT   CDS_pept        complement(665877..666518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06110"
FT                   /product="putative L-fuculose-phosphate aldolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24404"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI56"
FT                   /protein_id="ACP24404.1"
FT                   /translation="MAALSEETRTRDNIVRAGKSIFDRGLTFGSTGNISVKMSDGRMLM
FT                   TPTNASLGSLVPEQLSLFSAEGVHLGGDKPTKEAFLHRCMYCARQHGKAVVHLHSTYSV
FT                   AVSILKDVDEKDVLPPLTAYYVMRVGTLPLVPYFRPGDEKLATAVQEAAATSNAVLMAN
FT                   HGPVVAGRSLEEAQYATEELEETAKLFLMLHGRELRPLSPTQREELTKSI"
     atggctgcac tgtccgagga aaccaggacc cgcgacaaca tcgtgcgggc cggaaaatcg        60
     attttcgacc gcggcctgac attcggttcg actggcaaca taagcgtgaa gatgtcggat       120
     ggacggatgt tgatgacgcc cacgaatgct tcgctcggaa gcctcgtgcc tgaacaactt       180
     tcgctcttct ccgcggaggg cgttcacctc ggcggagaca agcccaccaa agaggccttc       240
     cttcaccgct gcatgtattg cgcgcggcag cacggcaagg ccgttgtcca cctccactca       300
     acatactcgg tggcggtcag tatactgaaa gacgtcgatg aaaaggatgt gctgcctccc       360
     ctgaccgcct attacgtgat gcgggtcggc accttgccat tggtgcccta cttccgtccc       420
     ggagacgaga agctggccac ggcggtacag gaggccgccg cgacaagcaa cgccgtcctc       480
     atggcgaacc acggacccgt cgtggctggg aggtcgcttg aggaggcgca gtacgcgact       540
     gaggaactgg aggaaaccgc gaaactgttc ttgatgcttc atggccggga actgagaccg       600
     ttgagtccga ctcagcgcga agaactcacc aagtccattt ag                          642
//

If you have problems or comments...

PBIL Back to PBIL home page