(data stored in ACNUC7421 zone)

EMBL: CP001389.PE609

CP001389.PE609       Location/Qualifiers
FT   CDS_pept        complement(674041..675639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06200"
FT                   /product="putative ribose ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06200"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24413"
FT                   /db_xref="GOA:C3MI65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI65"
FT                   /protein_id="ACP24413.1"
FT                   /translation="MTQPMQTPITDPRDVAAVKMTDIKKSYGGVHALKGVSLTIRPGTI
FT                   HALIGENGAGKSTLLKILQGVVIPTEGSIEVFGEHLTAVSPENSRRLGIGMIFQDLSLI
FT                   PTLTIAQNIFLNREPRRMSLLVDERREIEDAAKIIGELNLNVDPRTRVLELSPGQAQLT
FT                   EIAKAISQKARVLILDEPTSALSAQEVDILFKMLRKLTADGTAIIYVSHRMTEIMTIAD
FT                   EITILRDGQNVTSGNIADFTLDTIVQNMVGKRVTGFEYKPHEIDRGTQPALKVRSLSGK
FT                   HGKPSDVSFDLYRGEVLGIAGLMGAGRTELARVLFGVDAKADGTVELDGKVLEFRSPAE
FT                   AIEAGIVLVPESRHDQGLVIEHTVGHNLSLPQLAQLASGPFLDRRREHDLSSELISRLR
FT                   IKTPDADNKVRNLSGGNQQKIVIAKWLATDPSVVILDEPTAGVDIGSKAEIVELIRSIA
FT                   SGGKSVIVISSEPAELLATSDRILVLSNGRLAREISRSEIDAWATTEGDESQSSMIRVE
FT                   LGLQVAIQKASQNVQ"
     atgacacagc ccatgcaaac gccgatcacg gacccgcgag atgtcgccgc ggtgaaaatg        60
     accgacatca agaaatccta cggcggcgtc cacgcactca agggcgtgag cctgacgatc       120
     cgccctggca cgatccacgc cctgattggc gaaaatggcg cgggcaaatc cacgctgctc       180
     aaaatcttgc agggggtggt aattcccacg gaaggttcga tagaggtctt cggcgagcat       240
     ctgacggcag tctccccgga gaactcccgc aggcttggaa tcgggatgat cttccaggac       300
     ctgagcctca tccccacgct gacgatcgcg cagaacatct tcctgaaccg cgaaccccgc       360
     cgcatgtccc tgttagtcga tgagcggcgg gaaattgagg acgcggccaa gatcatcggg       420
     gaactgaacc tgaacgtcga tccgaggacg cgcgtcttgg agttgagccc cgggcaggcg       480
     cagctcaccg agatcgcgaa agccatctcc cagaaggcgc gcgtcctcat cctcgacgag       540
     ccgacgtcgg cattgagcgc gcaggaggtc gacatccttt tcaagatgct gcgcaaattg       600
     accgcggacg gcactgcgat catctacgtc tcccaccgca tgactgagat catgacgatc       660
     gcggacgaga tcaccatcct gcgcgacgga cagaacgtca cgtcgggcaa catcgcggat       720
     ttcacgctcg ataccatcgt ccagaacatg gtcggaaagc gggtgacggg attcgagtac       780
     aaaccccacg agatcgaccg cggcacccag cccgcgctga aggtgcgttc cctctcgggc       840
     aagcacggga agccgagtga cgtctcattc gatctctaca ggggcgaggt tctcggtatc       900
     gccgggctca tgggggccgg acggaccgaa ctggcgcggg tgctgttcgg cgtcgatgcc       960
     aaggccgacg gcacggtcga actcgacggc aaggttctcg agtttcggtc gcccgccgaa      1020
     gccatcgaag ccggtatcgt gctcgtgccg gaaagccgtc atgaccaggg tcttgtcatc      1080
     gaacataccg tcggacacaa cctcagcctt ccgcaattgg cccaactcgc cagcggcccg      1140
     ttcctcgatc ggcggaggga gcatgatctc tcctcggaat tgatctcgcg cttgcgcatc      1200
     aagaccccgg acgccgataa caaggtccgt aacctttcgg gcggaaacca acagaagatc      1260
     gtcatcgcca agtggcttgc gaccgaccca tccgtcgtca tcctcgacga gccgactgcg      1320
     ggcgtcgaca tcggctccaa agcggagatc gtcgagttga tcaggagcat cgcgagcggc      1380
     ggaaagtccg tgatcgtgat ctcgtcggag cccgccgagc tgttggcgac cagcgaccgg      1440
     atactggtgc tcagcaacgg tcgcctcgcg cgggagatca gccgatcgga gatcgacgcc      1500
     tgggcaacca cggaaggcga cgaatcgcag tcgagcatga tccgcgtgga actcggcctt      1560
     caggtcgcca ttcagaaagc tagtcaaaat gtccaatga                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page