(data stored in ACNUC7421 zone)

EMBL: CP001389.PE614

CP001389.PE614       Location/Qualifiers
FT   CDS_pept        680493..680963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24418"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI70"
FT                   /protein_id="ACP24418.1"
FT                   /translation="MTIPAYFGNFPFPPGDKKPHHLTADKFKMFIYTGNKPYSSDLNYL
FT                   LASTDKMTTGIYQLAPGSNFDPADIHAGDEVYYVLEGEVHLLNPETGHTERMGPGDSIL
FT                   IPMGVPHRGYNFTDKAAVILFCIAPRIWDEKGPPTGYFGATRLFKSERRVSE"
     atgacaatac ctgcatactt cggcaacttc ccgtttccgc caggggataa gaaaccgcac        60
     cacctgacgg cggacaagtt caagatgttc atctatacgg gcaacaagcc gtactcgagc       120
     gacttgaact acctgctggc gagcacggac aagatgacga cgggcatcta tcaactcgcc       180
     ccaggcagca acttcgatcc cgccgacatc cacgccggag acgaggttta ctacgtcctc       240
     gagggcgagg tgcatcttct caatccggag acgggccata ccgaacgaat ggggcctggg       300
     gactcgatcc tgatccccat gggcgtcccg caccgcggat acaatttcac cgacaaggcg       360
     gccgtcatcc tgttctgcat cgcgccgcgc atctgggacg agaagggacc gccgactgga       420
     tatttcggcg cgacgcgtct cttcaaatcc gaaaggaggg tctcggaatg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page