(data stored in ACNUC7421 zone)

EMBL: CP001389.PE615

CP001389.PE615       Location/Qualifiers
FT   CDS_pept        680960..681364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06260"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24419"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI71"
FT                   /protein_id="ACP24419.1"
FT                   /translation="MSLEKLGKYPVVGAEARSKGDLVKVAKENRLNLIFGQDHPVLMEL
FT                   CVSNDYMHVGEFVIPVGGVGPRASEPNRHDGDAVFYVLKGPATFYVADGDETFHIRDGE
FT                   AFFLPAGVSYQCLNYGSSPIRMVFTIAPGL"
     atgagcctgg agaaactcgg caagtacccc gtcgtcggcg ctgaggcccg ttccaagggc        60
     gacctggtga aggtggcgaa agaaaaccgt ttgaacctga tcttcggcca ggaccacccg       120
     gttctgatgg agctctgcgt atccaacgac tacatgcatg tcggcgagtt cgtcattccc       180
     gtgggcggtg tcggtccaag ggcgagcgag cccaacaggc acgatggcga cgctgtcttc       240
     tacgtgttga aaggcccggc aactttttat gtcgcggacg gcgacgagac gttccacatc       300
     cgggacgggg aggcgttctt cctgcccgcg ggcgtcagct accagtgcct gaactacggc       360
     tccagtccca tccgcatggt cttcaccata gcgcctggcc tctga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page