(data stored in ACNUC7421 zone)

EMBL: CP001389.PE616

CP001389.PE616       Location/Qualifiers
FT   CDS_pept        681423..682526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06270"
FT                   /product="putative ribose ABC transporter, ribose-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24420"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI72"
FT                   /protein_id="ACP24420.1"
FT                   /translation="MSCTTREDLVTTFKRRTLLCAAVAFAASVGFQPAFAAEPDYNAVF
FT                   PGILMDKDIKPTGQEMKPVKKDNRPLKLGFLPTAMDTYYQRVLAGVKEEIDKRGGAEAI
FT                   ELLVQAPSSQSATDDQIRAMEAWINDGIDAIAVALYNEGALLPSIRRATEAGIPVFLFN
FT                   SPFADNPYYVSDVGYDQSDGGRAQAQWIVDTYGDKEVKIGILEGLPGPHTSQRMKGFNE
FT                   IISKHPNFKIVAQQPAGWVRAQGLSVTENMFTANPDIEVLVALYDEMALGGLQALKAKG
FT                   LNGKVAIVGYENMKEANAAILTGDFSATVDTGAKEEGRNIVRAVDEFLMKGNPLPKKIF
FT                   VSPKVYDATNIKTFDQTDYDYVPQQKM"
     gtgtcttgca caacaaggga ggacctcgtg acgactttca aacgacgtac attgctttgc        60
     gcagcggtcg cgttcgccgc ttctgtcggc ttccagcccg cattcgccgc cgagcctgac       120
     tacaacgccg tgtttcccgg catcctgatg gacaaggaca tcaagccgac ggggcaggag       180
     atgaagccgg tcaagaagga caaccgtcct ctcaagctcg gcttcctgcc caccgcgatg       240
     gacacctact accagcgcgt tctggccggc gtgaaggagg agatcgacaa gcgcggcggc       300
     gcagaagcga tcgagctcct cgtccaggca ccgagcagcc agtctgcgac agacgaccag       360
     atcagggcca tggaagcctg gatcaacgac ggcatcgacg cgatcgcggt cgctctctac       420
     aacgaaggcg ctctgttgcc gtcgatccgt cgcgccacgg aagccggcat tccggtgttt       480
     ctgttcaact ccccgttcgc agacaacccg tactacgtca gcgacgtcgg ctacgaccag       540
     tcggacggcg gccgcgcgca ggcccagtgg atcgtggaca cctatggcga caaggaggtc       600
     aaaatcggca tcctcgaagg cctgccaggt ccgcacacca gccagcgtat gaagggcttc       660
     aacgagatca tctcgaagca tccgaacttc aagatcgtcg ctcagcagcc cgctggctgg       720
     gtccgcgcac agggtctctc agtgaccgag aacatgttca ccgccaaccc ggatatcgaa       780
     gtcctcgtgg cgctctatga cgagatggct ctcggtgggc tgcaggccct caaggccaag       840
     ggtctgaacg ggaaggtcgc catcgtcggc tatgagaaca tgaaggaagc gaacgccgcc       900
     atactgacgg gcgacttctc cgcaacggtc gacaccggag ccaaggaaga ggggcgcaac       960
     atcgtgcgcg ccgtcgacga attcctgatg aagggaaatc cccttccgaa gaagattttc      1020
     gtcagcccca aggtctacga cgccacgaac atcaagacgt tcgaccagac cgactacgac      1080
     tacgtccccc agcagaagat gtga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page