(data stored in ACNUC7421 zone)

EMBL: CP001389.PE617

CP001389.PE617       Location/Qualifiers
FT   CDS_pept        682575..684110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06280"
FT                   /product="putative ribose ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24421"
FT                   /db_xref="GOA:C3MI73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI73"
FT                   /protein_id="ACP24421.1"
FT                   /translation="MANNPLLEMKGIGKRFGNMVALQGIDLALSGGEVLGLVGENGAGK
FT                   STLMKILAGAYSRDGGTIAVRGKEVELDSPKAGADAGIAIIYQELSLFPDFNAAENIFA
FT                   GRELRRSGFSLAPLSHGQMRREARRLLSEELGVEVAIDRPVRELSLSDRQMIEIAKALN
FT                   SNADIIIMDEPTEALEEVERKQLFAIINRLQAAGKAIIYVSHRIKELLGICSRVMVLRD
FT                   GRTAADLPVADLDVDKVVAAMIGGALSKQFPPRVPPRSDPSVEVRGLSRAGAFDDISFS
FT                   LAKGEIFGIAGLEGSGKSALLRALFGQRAYERGTVKVEGKDVQLTDITDAIRERFAFLP
FT                   AERKFEGIFPEHSVGWNLSIGNLGVLGKITLRPSKEKEVAASYISKLGVKCEGPQAEIS
FT                   SLSGGNQQKVMLARWLLTQPKVLLLEEPTRGVDVRAKSEVYALVQAAAQDGCTVIVVSA
FT                   DNAELLGLCHRVAVMFEGKITTVVDAATSKEETLALHSVRPPETLHPVGGING"
     atggccaaca atccgcttct cgaaatgaag ggcataggca agcgcttcgg caacatggtc        60
     gctctgcagg gaatcgacct ggcgctgagc ggcggcgaag tcttgggctt ggtcggtgaa       120
     aacggcgcgg gcaaatccac gttgatgaaa attctcgcgg gcgcttattc acgcgacggc       180
     ggcacgatcg ccgtgcgggg aaaggaagtc gagctcgaca gcccgaaggc cggagccgac       240
     gccggcatcg cgatcatcta ccaggaactc agcctgttcc cggacttcaa cgcggccgag       300
     aacattttcg ccggacgcga gttgcggcgc agtggcttct cgctcgcccc gctgagccac       360
     gggcagatgc gcagggaagc gcgccgcctt ctttccgaag agcttggcgt ggaggtcgcg       420
     atcgaccgcc cggtccggga actgagcctt tccgaccgcc agatgatcga gatcgccaaa       480
     gcgctgaaca gcaacgccga catcatcatt atggacgagc cgaccgaggc gctcgaggag       540
     gtcgaacgca aacagctttt cgccatcatc aaccgtctgc aggctgccgg aaaggccatc       600
     atctacgttt cgcaccggat caaggaactg ctcggcatct gcagccgcgt catggtgctt       660
     cgcgacggcc gcacggcggc cgaccttccg gtcgccgacc tcgacgtcga caaagtcgtc       720
     gccgcgatga tcggcggtgc cctttccaaa cagtttcctc cccgcgtccc tccgaggtcc       780
     gatccctcgg tggaagtacg cggcctgtcg agagcgggag ctttcgacga catctccttt       840
     tcgcttgcga agggagagat ttttgggatc gccggcctgg agggctcggg caagagcgcg       900
     cttctccgag ccctcttcgg ccagcgggct tatgaacgcg gcaccgtgaa ggtcgaaggc       960
     aaggatgtcc aactgacgga catcaccgac gccatcagag agcgcttcgc atttctgccc      1020
     gccgaacgga agttcgaggg catcttcccc gagcattcgg ttggatggaa tctatcgatc      1080
     ggtaacttgg gcgtcctcgg gaagatcacc ttgcggccct ccaaggagaa ggaagtcgcg      1140
     gcgagctaca tctcgaagct cggcgtgaag tgcgaggggc cgcaggcgga gatcagttct      1200
     ctgagcggtg gcaaccaaca aaaggtcatg ctggctcgtt ggctgctcac ccaacccaag      1260
     gtgctcctgc tcgaggagcc gacgcggggc gtcgacgtcc gcgccaaatc cgaggtctac      1320
     gccttggttc aggccgccgc ccaggacggg tgcaccgtca tcgtggtgtc ggccgacaat      1380
     gccgagttgc tcggcctttg ccaccgcgtc gcggtgatgt tcgaaggcaa aatcacaacg      1440
     gtggtcgatg ccgccacgtc caaggaagag acgttggcgc tccattcggt gaggcctccg      1500
     gaaacccttc atccagtggg aggaatcaat ggctga                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page