(data stored in ACNUC7421 zone)

EMBL: CP001389.PE621

CP001389.PE621       Location/Qualifiers
FT   CDS_pept        687464..688420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06320"
FT                   /product="putative transcriptional regulatory protein, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24425"
FT                   /db_xref="GOA:C3MI77"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI77"
FT                   /protein_id="ACP24425.1"
FT                   /translation="MTSIPSIRAILSFVAAGRRGSFLEAAAQLQLTPSAVSHQIRLLEE
FT                   GLGEKLFHRIGRNVTLTEIGERYHRDLSEALSLIERATDEVSRRNSVDVLSVGCAPSLA
FT                   SLWLMPRLPQFESLHPSLEIRLISSSEPTKLSDGSVDVDICYGSVPRLGSIATEEFPLE
FT                   TIVVACAPEVANGERPIRRPSDLVGHTLIKSEQTLYSWRQWAKDHGLEIDLNRGSRFRD
FT                   AFMSIATAVEGRGVCLESYRLLQRDVERGNLVLPFGMTGPNLRCHTLTYVRSRLRSQKV
FT                   SAFKQWLESAWLEDAAALEMGSRASVGDRHQEHPFGL"
     atgacgtcga ttccgtccat ccgggccatc ctgtccttcg tcgcggcggg gaggaggggt        60
     tctttcctgg aggccgcggc ccagctgcag ctgacgccgt cggccgtcag ccaccagatc       120
     aggctgttgg aagagggcct cggagaaaag ctctttcacc gcatcgggcg gaatgtcacc       180
     ctcaccgaga tcggcgaacg gtatcaccgt gacttgtccg aagcgctgtc gttgatcgag       240
     cgcgccaccg acgaagtttc caggcgaaac agcgtcgacg tcctgagcgt cggctgcgct       300
     ccgagcctcg cgtcgctatg gctgatgccc cgacttccgc aattcgagtc gctccatccc       360
     tcgcttgaaa tccggctgat ttcctcatcg gagccaacca aactgagcga cggttcagtg       420
     gacgtcgaca tttgctacgg cagcgtgccc cgtctcggct ccattgcgac cgaggagttt       480
     cccctcgaga cgatcgtggt agcgtgcgct cccgaggtcg cgaacgggga gaggccgata       540
     cggcggcctt cggacctcgt cggccatacg ctcatcaagt cggagcaaac cctctatagc       600
     tggcgtcaat gggcgaagga tcacggtctc gagatcgatc tgaaccgggg atcgcgtttc       660
     cgcgacgcgt tcatgtcgat cgccacagcg gtcgaaggtc gcggcgtctg cttggaaagc       720
     tataggttgc tgcagcgcga cgtcgagagg gggaacctcg tccttccgtt cggaatgacc       780
     ggacccaatc tgcgttgcca cacgctcact tatgtcagat cgcgcctgag gtcgcaaaag       840
     gtgagcgcct tcaagcagtg gcttgagagc gcttggctcg aggacgccgc ggctctcgag       900
     atgggctcac gagcttcagt gggtgaccgt caccaagagc atcccttcgg gctttga          957
//

If you have problems or comments...

PBIL Back to PBIL home page