(data stored in ACNUC7421 zone)

EMBL: CP001389.PE623

CP001389.PE623       Location/Qualifiers
FT   CDS_pept        688806..689903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06340"
FT                   /product="putative exported solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24427"
FT                   /db_xref="GOA:C3MI79"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI79"
FT                   /protein_id="ACP24427.1"
FT                   /translation="MRIGSLICGGIAALIVAMTTSAQAETRTLRFQSAYPASSTIYMSA
FT                   ETWAKRVEELSGGRLKIEFMPAGTIVPAFEVLDAVNKNVIDGGHSTVAYWVGKHRAGTL
FT                   FGDAAGGPFGMDILDYVGWLYEGGGIELYRDYYRVELKTNIEVIPSVTSANQALGWFAR
FT                   PVESWADLKGRKCRQTGVTAEVFASSGMSTVNMPGGEIVPAGERGVIECAEFVGPAEDM
FT                   GIGFQTIWKHFYPMSTHNPATIVDFLVNGDVWNSLAPDLQAIMQAAASEATLRSHIRKG
FT                   KLDADALDKMRNEDGVTVHRTPDDILRNILASWDEIAKKESESNAFFKKVYDSQRDYAS
FT                   KVVPAKRLIQAPYNLGADHYWPEAK"
     atgagaattg gatcgcttat ttgcggtggc attgccgcgt tgatcgtcgc aatgaccact        60
     tcggctcagg ccgagacgag aacgctacgc tttcaatcgg catacccggc atccagcacg       120
     atctacatgt cggcggagac gtgggcgaag cgcgtcgaag aactctcggg cggcaggctg       180
     aaaatcgaat tcatgcccgc gggcacgatc gtccctgcat tcgaggtgct ggatgcggtc       240
     aacaaaaacg tgatcgatgg cggccattcc actgtcgctt attgggtcgg caaacatagg       300
     gcaggaacac tcttcggcga cgctgccggg gggccgttcg gcatggacat cctcgactac       360
     gtcggctggc tttacgaggg aggcggtatt gagctttacc gcgactacta tcgcgtagag       420
     ctgaagacca acatcgaagt aatcccgtcc gtcacgagcg caaatcaggc gctgggatgg       480
     tttgcacgcc cggttgagag ttgggcggac cttaaaggcc gcaaatgccg ccagactggc       540
     gtgacagctg aagttttcgc ctcctcgggt atgtctacgg tgaacatgcc cggcggcgag       600
     atcgtcccgg caggtgagcg aggtgtcatt gaatgcgctg aattcgtcgg cccggcagaa       660
     gatatgggca tcgggttcca gacgatctgg aaacatttct atccaatgtc gacacacaat       720
     cccgcgacga tcgtcgattt ccttgtgaac ggtgacgtct ggaactcgct ggctccggat       780
     ctccaggcca tcatgcaggc tgccgcaagc gaagcgaccc tgaggtcgca tatccggaaa       840
     ggcaagctcg acgccgatgc gcttgacaag atgcgcaacg aagacggcgt gaccgttcac       900
     cgtacccccg acgacattct acggaacatt ctcgcctctt gggacgaaat cgcgaagaag       960
     gaaagcgagt ccaacgcctt cttcaagaag gtatatgact cccaacgcga ctacgcgtcg      1020
     aaagtcgttc ccgcaaagcg gctaatccag gctccctaca atctcggtgc ggaccattac      1080
     tggcccgaag ctaagtag                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page