(data stored in ACNUC7421 zone)

EMBL: CP001389.PE624

CP001389.PE624       Location/Qualifiers
FT   CDS_pept        689959..690522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06350"
FT                   /product="putative transporter DctQ-related transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06350"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24428"
FT                   /db_xref="GOA:C3MI80"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI80"
FT                   /protein_id="ACP24428.1"
FT                   /translation="MSKPAPPFSPAALRAIKIIDGFTEKFVLLVAVLTIPLVLSNTVEV
FT                   VSRYLFSSPTIWAADATVMSYGAIFMLGSSYALLKGAHVRTDIFWESFSDRKKGAIDAV
FT                   CYVALFLPVMAIIFYMSLDDFLYSYEINEKSTLSLWMPVIWPLRGVIPLTAVLLFFQGI
FT                   SELLKSLFAVTTGRAFETHEKIEI"
     gtgagcaaac ctgcaccccc attctcgccc gccgcactcc gggcgatcaa gatcatcgat        60
     ggcttcaccg agaagttcgt acttctggtc gctgtcctca ctatcccgtt ggttctatcc       120
     aacacagtgg aagtcgtctc gcgctatcta ttttcgtctc cgacgatctg ggcagctgac       180
     gcgacggtga tgtcatatgg cgcgatattc atgctcgggt catcatacgc cctgctgaag       240
     ggcgcacatg tgagaaccga catattctgg gaaagcttca gcgatagaaa gaaaggcgcg       300
     atcgacgccg tctgctatgt cgccctgttt cttccggtga tggccatcat cttctatatg       360
     tcgctggacg acttcctcta ctcatacgaa atcaacgaga aatccaccct gagtctatgg       420
     atgccagtta tctggccgct gcgaggcgtc atcccactga ccgcggttct tctctttttc       480
     cagggaattt cggaactgct caagtcactg ttcgcagtga ccaccgggcg ggcgttcgag       540
     actcacgaaa agatcgagat ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page