(data stored in ACNUC7421 zone)

EMBL: CP001389.PE625

CP001389.PE625       Location/Qualifiers
FT   CDS_pept        690535..691872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06360"
FT                   /product="putative TRAP family transmembrane transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24429"
FT                   /db_xref="GOA:C3MI81"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI81"
FT                   /protein_id="ACP24429.1"
FT                   /translation="MSFNDILSVAMLGGMLAFIFVGFPIAFTLLFIALVFGSIGIGVNI
FT                   TFSLAYLQIFGTMKDDILPAVPLFIFMGYMTEQAGLMNRLFGSMRQIMAPLSGSLFLAV
FT                   LLTATIFAMATGIVGAAVTVLGIMAGPMMIKAGYDAKLSAGAIAAGGTLGILIPPSVML
FT                   VVMGPTLGVPVNQLYGAAMAPGFMLAVCYATYCVARSYINPRVGPILPIEERVGSAIEI
FT                   TREFVVGVLPLCLLIVATLGSILSGLATPTEAASCGAVGATILALAYRKLSFWTLKNAA
FT                   VATVVTSSMVLLLAVASNVFGAVFTQQGGAAIITDVVTSIPVSDMWKLVIIMVIIFALG
FT                   WPFEWPAIVLVFLPIFTPIVLQLDLGMTKPELLLWFGVLVAVNLQTAYLSPPVAMSAYF
FT                   LRNVVPQWSLKLIYSGMGQFMVIQIVFLIALLMWPSLVLWLPSVLK"
     atgagtttca acgacattct cagcgtcgcc atgctgggtg gcatgctcgc tttcattttc        60
     gtcggctttc cgatcgcgtt cacgcttctc tttatcgcac ttgtcttcgg ctcgatcggg       120
     atcggtgtga acataacctt cagcctcgcc tatctacaga ttttcgggac gatgaaggac       180
     gacattctcc cggcggtccc actcttcata ttcatgggtt acatgaccga gcaggcgggc       240
     ctgatgaacc gattgttcgg ctccatgcgg caaatcatgg ctcccttgag cggttcccta       300
     tttcttgccg tgcttctcac ggcgacgatc ttcgcgatgg ccacgggtat cgtgggagcc       360
     gcggtgaccg tcctcggcat catggccggg ccgatgatga taaaggcggg ctacgatgcg       420
     aagttgtcag cgggtgccat cgcagccggt ggcacgctcg ggatcctcat tccgccgagc       480
     gtgatgctcg ttgtaatggg accgactctc ggagtgcccg tgaaccagct gtacggagcc       540
     gcgatggcac ccggcttcat gctggctgtt tgctatgcga cctactgcgt cgcacgaagc       600
     tatataaatc cccgcgttgg tccgattcta ccaatcgagg agcgggtagg tagcgcgatc       660
     gagatcacgc gcgagtttgt tgtcggcgtt ctaccgctgt gcctgcttat cgtcgcaact       720
     ctcggctcca ttctgtccgg attggccacc cctacggagg ccgcgtcttg cggagcggtg       780
     ggggcaacaa tcttggcact cgcttaccgc aagcttagtt tttggacgct gaagaatgcc       840
     gcagtggcca cggtagttac ctcgagcatg gttctcctcc tcgcggtagc gtcgaatgta       900
     ttcggcgctg ttttcactca acaaggtgga gcggcgatca tcacggacgt cgtcacgagc       960
     attcctgtct cggacatgtg gaagctcgtc atcattatgg tcatcatatt cgctcttggt      1020
     tggccctttg agtggcccgc cattgttctg gtgtttctcc cgatcttcac gccgatcgtc      1080
     ctccagctcg acttgggaat gaccaagccg gaactcctgc tttggttcgg tgtacttgtc      1140
     gcggttaatc tacagaccgc atatttgagt ccgcccgtgg cgatgtcggc atatttcttg      1200
     aggaacgtcg tcccccagtg gagcttgaaa ttgatctaca gtgggatggg gcagttcatg      1260
     gtgatccaga ttgtgttctt aatcgccctg ctgatgtggc cgtcactagt gctttggctt      1320
     ccgtccgtcc ttaagtaa                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page