(data stored in ACNUC7421 zone)

EMBL: CP001389.PE626

CP001389.PE626       Location/Qualifiers
FT   CDS_pept        692205..693206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06370"
FT                   /product="putative AraC family transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24430"
FT                   /db_xref="GOA:C3MI82"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI82"
FT                   /protein_id="ACP24430.1"
FT                   /translation="MRRGNLAGKEDYVVVECTDPAELSSILSGSETKVTVKPTARSGIQ
FT                   FRCEYAAAELLGLALCRYQGSAVFEHESANEKYLIFLPRYGFAAINVNGARVLTSPRQG
FT                   AIVACQQAKSLTLSGPMEHLVVVVDRATLSSRLMDMLEVPVSGGFDFFPEIDLTAGPGL
FT                   IIAQTAAALHSGLAASAALRNAPVARTSFANALVELLLESLPHRHTSELNRRTSPMPRH
FT                   VKRAVEFMRANLSKPLTIQEIALASGSGIRSLQDGFRRFKQTTPSSYLQYLRLDAVHQE
FT                   LLQAKSSQTVCDIARKWGFSHSGRFAADYRKRFGQAPSQTLQSSSFRIRPPG"
     atgcgtcgag gaaatcttgc aggtaaagaa gactacgtcg tcgtcgagtg caccgatccg        60
     gctgaactct catcaatcct ttccggctct gaaacgaaag ttactgtgaa gcccactgca       120
     agatctggaa tccaattcag gtgtgagtac gcggccgctg agctcttagg tctggccctc       180
     tgtcgctacc aaggaagtgc tgttttcgag cacgagagtg caaatgaaaa atatctgatt       240
     ttcctcccac gatatggttt cgccgcaatc aatgtaaacg gcgcaagggt tctgacctcg       300
     ccgaggcaag gcgcaatagt cgcctgccag caggccaaga gcctcacctt gtccggccca       360
     atggagcatc tcgtcgtagt ggtcgaccgg gcgacgctct ccagccgttt gatggacatg       420
     ctggaggtgc cggtgtcggg aggatttgat ttctttccgg agatcgactt aacggctgga       480
     cctggtttga taattgccca aacggccgcc gcgctccact ctgggctggc cgcaagcgcg       540
     gcgttgcgca acgcgccggt cgctcgtacc agcttcgcca acgccctggt tgaactgctg       600
     ctggagagct tgccacaccg tcatacatcg gaactaaatc ggcggacgtc gcccatgcct       660
     cgtcacgtca agcgggcggt tgagtttatg agagcgaacc tttcgaaacc cttgaccatt       720
     caagagatcg cgctggcatc gggatccgga atacgaagcc ttcaagatgg ctttcgacgt       780
     ttcaaacaaa caactccgag ttcttatctg cagtatttga ggcttgacgc cgttcaccaa       840
     gaactcttgc aggctaagtc ctcgcaaacg gtatgcgaca tcgctcgtaa atggggtttc       900
     tctcattccg gccgcttcgc cgctgactac cgaaagcgtt tcgggcaagc accttcacag       960
     actttgcagt cgtcaagttt tcgcatccga ccaccgggtt ag                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page