(data stored in ACNUC7421 zone)

EMBL: CP001389.PE631

CP001389.PE631       Location/Qualifiers
FT   CDS_pept        697284..698630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24435"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI87"
FT                   /protein_id="ACP24435.1"
FT                   /translation="MEGKRPLVGFYGDDFTGSSENLAQFHRNGLRTRLYLRVPSQETLA
FT                   EATRDLDVVGFAGTARALDNSQITAEVFPAFKALGALGCTFLQYKICSTFDSAPQVGNF
FT                   GFAAEQLAGGGGEYDLVVLAATPDFGRYTAFGNHYAKFGSEIVRLDRHPSMSNHPRTPM
FT                   KESDLRRHLADLCSLDFTNIFLPEIRDEATLSKRLENLLANRKGVVFDGVDNRDLDNIA
FT                   SALWEHHKKRPVFAIAAQGLAQALGKQLAKHKNPLDLLDVGTTIAPASNLLVLSGSCAI
FT                   QTGRQIDAAVQAGWAALELNPLELTDGRAVARKIELVKPQIMAHLANERPTIVYTARGH
FT                   AMDRDRFEDIPPQLIGEAYANLMVAARRETDVQRVVLAGGDSSSYAVRQSAAESLTIKV
FT                   FDRVQHGHLCELMGGGLDGLEVLLKGGQVGDDDYFMRVLHGTEKQHVEA"
     atggaaggga agaggccact cgttggcttt tacggtgacg atttcaccgg ttcgtcggaa        60
     aaccttgcgc agtttcaccg caacggcctg agaaccaggc tttatctgcg ggttccatcg       120
     caggagacgc tggcggaagc aactcgcgac ctggatgtcg tgggatttgc gggaacggcg       180
     cgagcactgg ataactcgca gatcacagcc gaagtatttc cggccttcaa agcgctcgga       240
     gcgttaggct gcacgttcct gcagtacaag atctgctcga ccttcgattc cgccccgcag       300
     gtcggcaact tcgggttcgc cgcggaacag ctcgcggggg gcggaggcga atacgacctg       360
     gttgtcttgg ctgcaacgcc cgacttcggc cgctacacgg cgtttggcaa ccactatgcg       420
     aaattcggtt ccgagatcgt gcgactggat cggcatccga gcatgtcgaa ccatccacgt       480
     actccgatga aggaatctga tctccggcgg cacctggccg acctgtgctc cctcgatttc       540
     accaacatat tcctgccgga gatccgggac gaagcgacac tgtcgaaacg cctcgaaaat       600
     ttgcttgcca acaggaaggg cgttgttttc gacggcgtgg acaatcgcga tctcgacaat       660
     attgccagcg cgctttggga gcatcacaaa aaacggccgg ttttcgcgat agcggcccag       720
     ggtcttgctc aggcactcgg caagcaactg gcgaaacaca agaatccgct cgatcttctc       780
     gacgtaggaa cgaccatcgc acccgcgtcc aacctgctgg tgctgtcggg cagctgcgcc       840
     attcagacgg gccgccagat cgacgctgcg gttcaggcgg gctgggcggc gcttgagctc       900
     aatccgctcg agcttaccga cggtcgggcg gtcgcacgca aaatcgaact cgtcaaaccg       960
     cagatcatgg cccacctcgc caatgagcgg ccgacgatcg tctacaccgc acggggtcac      1020
     gcaatggacc gcgacaggtt cgaggacatt ccgccccagc tcattggcga agcctatgcc      1080
     aatctcatgg tcgcggccag aagggagacg gatgtccagc gggtggtcct agccgggggc      1140
     gatagttcga gctacgcggt ccggcagagc gcggcggagt cgctgacgat caaggtcttc      1200
     gatcgggttc agcacggtca tctttgcgag ctgatgggcg ggggattgga cgggctcgaa      1260
     gttctcctca aaggaggtca ggtcggcgac gacgactatt tcatgcgcgt gcttcacggc      1320
     accgagaagc agcacgtgga ggcttag                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page