(data stored in ACNUC7421 zone)

EMBL: CP001389.PE632

CP001389.PE632       Location/Qualifiers
FT   CDS_pept        698632..699513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24436"
FT                   /db_xref="GOA:C3MI88"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI88"
FT                   /protein_id="ACP24436.1"
FT                   /translation="MKKLILEARINEYAMRDHNRNVPWTSDEIAETAARVREEGASILH
FT                   FHARTVDGQPWNTFEAYDDIIRKVKAKSDILILPTLGFISNDADARNRIDNVVRLAQDP
FT                   ITKPDIAPIDTGSANLETFDRESGNVSFAERIYVNTTDSLVHYARELKQAGVKPKMVSW
FT                   SVGFTRRALMLMDMGLIDEPGYMLFHMTDGKTITGHPGTRQGLEAHLMFLPPDRRIEWT
FT                   ANVLGGNLLALADTIATRGGHLAMGIGDYPYPELDYPSNEVLIRETVRVIRAAGREPAT
FT                   PEEVRQMLDLSN"
     atgaagaagc ttatacttga ggcgcgcatc aacgagtatg caatgcgcga ccacaatagg        60
     aacgttcctt ggacctccga cgagattgcg gagaccgcag ctagggtgcg tgaagaaggc       120
     gcgtcgatcc tgcacttcca cgcgcgaacg gtcgacggcc agccatggaa tacgttcgaa       180
     gcttacgatg atatcattcg taaggtgaag gctaagtcgg acattctcat ccttcccacg       240
     ctcggcttca tctcgaacga tgccgatgcc cgtaaccgga ttgataatgt ggttcggctt       300
     gcgcaagacc cgataacgaa gccggatatc gcacccatcg ataccggaag cgccaatctc       360
     gagaccttcg accgcgaaag cggcaacgtt tcctttgccg agcgtatcta cgtcaacaca       420
     accgactcgc tcgtgcatta tgctcgcgaa ctaaagcagg caggcgtgaa gcccaagatg       480
     gtaagctggt ccgtcggctt taccaggcgg gcgctcatgc tgatggacat gggattaatc       540
     gatgaaccgg gctacatgct gtttcacatg acggacggca agacgattac cggtcatccc       600
     ggaacccggc aggggctcga ggcacatttg atgttcttgc cgccagaccg acggattgaa       660
     tggacggcaa acgtgctggg cggcaacctg ctcgcactcg cagataccat tgccacacgg       720
     ggcggccacc tagccatggg tatcggcgac tatccttatc ccgagctcga ctatccttca       780
     aacgaagttt tgatccgcga gactgttcgg gtcattcggg cagcgggaag ggagccagct       840
     actccagagg aggtccgtca aatgcttgat ctgagtaact aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page