(data stored in ACNUC7421 zone)

EMBL: CP001389.PE633

CP001389.PE633       Location/Qualifiers
FT   CDS_pept        699661..700068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06440"
FT                   /product="putative short chain oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24437"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI89"
FT                   /protein_id="ACP24437.1"
FT                   /translation="MNSGRPLAMVTGASSGIGFELARQFAKKGFDIALSGSSEKIFEAA
FT                   EKLRSDGTETFAFRADAGTYEGVEAFWRFVMHLKRPVDACAPNVTIAVGGAFAETALED
FT                   DLRVIAVNVTGTVHMRNTSSGIWLRTAMAAF"
     atgaatagcg gtcgtccttt ggcaatggtg acgggcgctt cgtccggtat aggtttcgag        60
     ctcgctaggc aatttgcgaa aaagggattt gatatcgcgc tgtctggctc cagcgaaaag       120
     atcttcgagg cagctgaaaa acttcggagt gacggcactg aaacattcgc gtttcgggcc       180
     gacgcaggaa catacgaagg agtcgaagct ttctggcgct tcgtgatgca tctaaagcgt       240
     ccggtcgatg cgtgcgcgcc gaatgtgacc attgcagtag gcggagcctt tgccgagact       300
     gctttggagg atgatctgcg tgtcatagca gtcaacgtca ccggaacagt tcacatgcga       360
     aacacgtcgt caggcatatg gttgcgaacg gcaatggccg cattctga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page