(data stored in ACNUC7421 zone)

EMBL: CP001389.PE634

CP001389.PE634       Location/Qualifiers
FT   CDS_pept        700038..700445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06450"
FT                   /product="putative short chain oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24438"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI90"
FT                   /protein_id="ACP24438.1"
FT                   /translation="MVANGNGRILIVSSVSATSPTPFETTYGPSKAFGFSFAESLREEL
FT                   RGTGVTVTALLPGATNTKFHANAGMADTPIGKAMKNDRELVAKQGFDALMNDIDHVVGG
FT                   DDATKQVVIENRKLTETVKAARHAAIARIGT"
     atggttgcga acggcaatgg ccgcattctg attgtatcgt cggtttccgc cacatccccc        60
     acgcccttcg aaacaaccta cggtccctcg aaagcgtttg gtttttcgtt cgccgagtcg       120
     ctgcgtgaag aactgagggg aacgggtgtt acggtaacgg ccctgcttcc aggcgcgacg       180
     aatacaaaat tccatgccaa tgctggcatg gccgacacgc cgatcggaaa agcgatgaaa       240
     aacgatcggg agctcgtcgc gaagcagggg ttcgatgctc ttatgaacga cattgaccat       300
     gtcgtgggtg gagacgatgc gaccaaacag gtggtgatcg aaaatcgcaa gctgacagag       360
     accgtcaaag cggctcgcca tgccgcgata gcgcgaatag gaacataa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page