(data stored in ACNUC7421 zone)

EMBL: CP001389.PE637

CP001389.PE637       Location/Qualifiers
FT   CDS_pept        complement(703507..704373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24441"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI93"
FT                   /protein_id="ACP24441.1"
FT                   /translation="MGAHSVWVLEYARSPVHPVSGVYYGAHNQGTMNLPFAYILIRTAD
FT                   AVALVDVGHDANDFGGEIANSIGVTGWTPPEIVLGECGVRPEDVTHIFITHAHFDHIGG
FT                   LKFFPNAKIFIQKKELESWMWILAKGRRFRSLLAGLNPADILYLTQANIEGRLELLEGP
FT                   REDVLPGIHLYPAHDTHTAGSQYVVVQNRGSDDRLVLSGDVVYTYRNLTGDDQLDPCFV
FT                   PPGLANGSQTKLIQAAEEMLGIVGNDERRIIPVHEEKLAQFYPSRLSDHGLRIVEICVA
FT                   DGEQSRV"
     atgggagcgc attccgtttg ggtgcttgag tatgcccgaa gccctgttca cccggtgagc        60
     ggtgtctatt acggcgccca taaccaggga acgatgaatc taccattcgc atacattctg       120
     atcaggacgg ccgatgcggt cgcattagtc gacgtcggcc acgatgcgaa cgatttcggg       180
     ggagagatag cgaactcgat cggagtaacc gggtggacgc cgccggagat agtgctgggt       240
     gaatgtggcg tccggcctga ggacgtgact cacatcttca taacgcacgc ccacttcgat       300
     cacatcggcg gcctgaagtt ctttcccaat gcaaagatct tcattcagaa gaaggagctc       360
     gaatcctgga tgtggatcct tgccaagggt cgccggtttc gatcgctgtt ggctgggctg       420
     aaccccgccg atatacttta tcttacccag gcgaacatcg agggcagact ggaacttctc       480
     gaaggaccga gagaagatgt gcttccgggc attcacctgt atcccgccca cgacactcat       540
     accgcgggct cccagtatgt agtggtgcaa aacagaggca gcgatgacag gctggtcttg       600
     tccggagacg tcgtctacac ctaccggaac ctgactggcg acgatcaact cgatccttgt       660
     ttcgtccccc caggccttgc gaatggcagc cagacgaagc tgatccaggc agcggaagag       720
     atgctgggca tcgtggggaa tgacgagcgt cggatcatac cggtgcatga ggaaaaattg       780
     gcccaattct atccctcccg cctgagcgat cacgggctgc ggatagtcga gatctgcgtc       840
     gcggacggag agcaatcgag ggtttga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page