(data stored in ACNUC7421 zone)

EMBL: CP001389.PE638

CP001389.PE638       Location/Qualifiers
FT   CDS_pept        complement(704345..704845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24442"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI94"
FT                   /protein_id="ACP24442.1"
FT                   /translation="MGYQRALIPFSCNEVANAVELQEQRSGLETLVRAYGEVLALFSFM
FT                   HLGLREPGMNLLFAQLSCRAADILESVGQGGDKRRRLAALEHAARHLGRVRSDLLQAQR
FT                   SFEGLLGRQSTELLRLLTRASLELKRASALLGTMTFDASGCCAGPLFANAEETHGSAFR
FT                   LGA"
     atggggtatc agcgggccct tattccgttc tcctgcaacg aagtcgcaaa cgccgttgaa        60
     ttgcaggagc agcggtctgg actggagacc ctggtccggg cttacggcga ggtgctcgca       120
     ctgttctcgt tcatgcacct cggcttgaga gagcccggca tgaatctgct cttcgcccag       180
     ctgtcgtgcc gtgccgccga tatactggag tccgtcggac aggggggcga caaaaggagg       240
     cgcttggcgg cactcgaaca tgcagctcgg catctcggcc gagtccgctc tgacctttta       300
     caggcccaga ggtcattcga aggactgctg ggaaggcaga gtaccgagct cttgaggttg       360
     ctgacgagag cttcgttgga attgaaacgg gcatctgcgc tattgggcac catgacattc       420
     gacgcgagcg gatgttgcgc agggcctttg ttcgcaaacg cggaggaaac acatgggagc       480
     gcattccgtt tgggtgcttg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page