(data stored in ACNUC7421 zone)

EMBL: CP001389.PE639

CP001389.PE639       Location/Qualifiers
FT   CDS_pept        complement(704851..705894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06500"
FT                   /product="putative aldo/keto reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24443"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI95"
FT                   /protein_id="ACP24443.1"
FT                   /translation="MMSDLAKRPLGKSNVRVTSLGLGTVPISGFNADVSYDEFEQTILS
FT                   GYAAGIRYFDCAPMYGFGKSEHFLGHALRVNKLRDDVVVSTKVGRVLKPASRTKKLDTV
FT                   YGIEWIDPLPFLDTYDYTYDGIMRSFEDSQQRLGLDYIDVLLVHDVGRAWHGDRSEFYW
FT                   DQLRASGYKALDELRSTGCVSAIGLGVNETDSVVGVSREFPIECALVAGRYTLLNHEPL
FT                   HSAFDELLSRNVSIIAGGIFNSGILASGTSGATATYDYGKVPAAVLDRVKSIEAVCEEY
FT                   RVSLPAAAMQFVYAHPAVATLVMGAKSSAEVDQNVAAINERIPPAFWNALQSADLLPAT
FT                   APLPAEA"
     atgatgtcgg acctggcaaa gcgcccgctc ggcaaatcga atgtgcgggt aacgtcactg        60
     gggcttggaa cggttcccat ttcgggcttc aacgcggacg tatcatacga cgagttcgag       120
     cagacgattc tgtcgggtta cgctgccggc attcgatact tcgactgcgc tcccatgtac       180
     ggcttcggga agtccgagca tttcctgggc catgccctga gagtgaataa gctgcgagac       240
     gacgtcgtcg tgagcaccaa ggtcggccgt gtcctcaagc cagccagccg cacgaaaaag       300
     ctcgacaccg tctatggaat cgagtggatc gatcccctgc ccttcttgga cacctacgac       360
     tacacctacg acggtatcat gaggtcgttc gaggacagcc agcagcgtct tggtctcgat       420
     tacatcgatg tcctgctcgt acatgatgtc gggcgcgcct ggcacggcga tcgaagcgag       480
     ttctactggg atcagttgag agcctccggg tacaaggcat tggacgaact gcggtccacc       540
     ggctgtgtct cggcgattgg cctcggagtc aatgaaacgg attccgtcgt aggtgtctcc       600
     cgggagttcc ctatcgagtg cgccctggtg gccggacgct acacattgct caaccacgaa       660
     cccctgcact ccgccttcga cgagcttttg tcgagaaatg tctcaatcat cgcaggcggc       720
     atcttcaatt cgggtatttt ggccagcgga acctctggcg caacggcgac atacgactac       780
     gggaaagtcc cggccgccgt cctcgaccgc gtcaaatcga tcgaagctgt atgcgaggaa       840
     taccgggtca gcttgccggc tgccgcaatg cagttcgtat atgcccaccc cgccgtggcc       900
     acactagtca tgggcgcgaa aagcagtgct gaagtcgatc agaacgtggc ggcgatcaac       960
     gagcgcattc cgcccgcatt ctggaacgcc ctgcaatcag ctgatctgct gccagcaact      1020
     gcgccactcc ctgcggaggc gtga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page