(data stored in ACNUC7421 zone)

EMBL: CP001389.PE642

CP001389.PE642       Location/Qualifiers
FT   CDS_pept        complement(708048..709034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06530"
FT                   /product="hypothetical ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24446"
FT                   /db_xref="GOA:C3MI98"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI98"
FT                   /protein_id="ACP24446.1"
FT                   /translation="MNANITKIATGTPSERRKAEITKDFIKSFSIILVFLAICVLFTSL
FT                   NQYFLTWNNWLNLLRQSSINGILAIGVTFVILTKGIDLSVGSVMALAGMMAANLVTTGN
FT                   EHLVIWSILAALGTGAVVGLANGVLIARINVPPFVATLGMLSMARGLTLIYSDGRPIAN
FT                   LTASLRWIGSGNVLGLPVPVLIFFAVFLIGWLTLSRTTFGRYVYAVGGNEKAARTSGIS
FT                   TRTIIAATYVICGLLAGLAGLVLTARTTAALPQAGIGYELDAIAAVVIGGTSLSGGRGS
FT                   LVGTLFGALIIGTINNGMDLMGVSSYYQQLLKGAIIVLAVIADQIRK"
     atgaacgcta acatcaccaa gatcgccacc ggcactccgt cggagcgcag gaaagccgag        60
     atcaccaagg acttcataaa gtccttcagc atcattctgg tgtttctcgc aatctgcgtg       120
     cttttcacct cgctgaacca gtacttcctc acctggaaca actggctcaa ccttcttcgc       180
     cagtcgagca tcaacggcat tctcgccatc ggcgtcacgt tcgtcatcct gacaaagggc       240
     atcgacctgt cggtcggatc ggtcatggca ctcgccggaa tgatggcagc caacctggtg       300
     acaaccggga acgagcacct tgtgatctgg agtattcttg cagcgctcgg taccggagcc       360
     gtcgtcggcc tcgcgaacgg ggttctcatc gcccggatca acgtgccgcc ttttgttgcg       420
     acgctcggaa tgctgagcat ggccaggggc ctcactctaa tctattccga cggcaggccg       480
     atcgctaacc ttaccgcttc cctgcggtgg atcggcagcg gaaacgtcct tggcctccct       540
     gtccccgtcc tcattttctt cgccgtgttc ctgattggct ggctcacgct ctcgaggacg       600
     acttttggac gctacgtcta cgccgttggc ggcaatgaaa aagcggccag gaccagcggc       660
     atctcgaccc gtaccatcat cgctgccacg tacgtgatct gcggtctgct cgccgggctt       720
     gccggacttg tgctgacggc ccgcacgacg gcggcactgc cgcaggcggg catcggctac       780
     gaactcgacg ccatcgcggc agtcgtgatc ggcggcacga gcctctcggg cggacgcggc       840
     tcactcgtag ggaccctctt cggcgcattg atcatcggca ccatcaacaa cgggatggat       900
     ctgatgggcg tgtcgtcata ttaccagcaa ctattgaaag gagccatcat agtcttagcc       960
     gtgatcgcag accagatacg caagtaa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page