(data stored in ACNUC7421 zone)

EMBL: CP001389.PE643

CP001389.PE643       Location/Qualifiers
FT   CDS_pept        complement(709105..710652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06540"
FT                   /product="hypothetical ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24447"
FT                   /db_xref="GOA:C3MI99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI99"
FT                   /protein_id="ACP24447.1"
FT                   /translation="MALGGFMTTGSVTFDTTLHSTTGNGLLLEADGVAKAFHGVPALRN
FT                   GHLKLRPGSVHALCGGNGAGKSTFLNIVMGLLRRDEGSIKIKGEVVDFRSASEALDHGI
FT                   AIITQELSPVLEMTVAENIYLGREPKRLGAFIDFALLETQAQKLLDDIGFPIRANARMS
FT                   NLSLAETQLVEIAKALSFDADIVIMDEPTSAIGEHEAHILFAAIDRLKHRGSGIIYVSH
FT                   KLSEIFEIADEFTVFRDGNYIVSGSMKETTRKELVTHIVGREVKVVEKERPNAGAPILL
FT                   EVRNLSRESEFKDISISVAAGEVFGIYGLLGSGRTEFLEAVYGMETPTSGEVMLAGRPV
FT                   PRGKPRESIKMGMAMVSEDRKDSGLVLSSSIAHNITLSALSLMAVSGFVKQQKEREVVE
FT                   EMIRSQRIKTSSSELAVENLSGGNQQKVVFARCLTTNPRLLICDEPTRGIDEGSKQEIY
FT                   AFLRDFAAKGHGVLVVSSEAPEILQVSDRIAIFKAGTLVDVIDGHGATQQMIMELAS"
     ttggccttgg gaggttttat gacgacggga agtgtcacat tcgacaccac actacactcg        60
     acgaccggaa acggtcttct gctagaggcg gatggtgttg cgaaggcgtt tcatggcgtt       120
     ccggcactgc gtaacgggca cctgaagctt cgtccgggga gcgtccacgc cttgtgcggg       180
     ggaaatgggg ctgggaagtc caccttccta aacatcgtta tgggtcttct gcgcagggac       240
     gagggcagca tcaagattaa gggtgaagtg gtcgatttcc gctccgccag cgaggcgctc       300
     gatcacggca tcgccatcat cacccaggag ctttctccgg ttctggaaat gactgtcgcc       360
     gagaacatct atctcggaag ggagccaaaa cgtcttgggg ccttcatcga ttttgcccta       420
     ttagagacgc aagcgcagaa gctcctggac gacatcggct tcccgatccg tgccaatgcc       480
     cgtatgtcaa atctcagcct cgccgaaacc cagttggtcg agatcgccaa ggcgctgagc       540
     ttcgatgcgg atatcgtcat catggacgag ccgacttccg cgatcggcga gcacgaagcc       600
     cacatcctgt tcgcggcgat cgatcgtctg aagcatcgtg gctcgggcat tatctacgtt       660
     tcacacaagc tctcagaaat cttcgagatt gcggacgagt tcacggtctt ccgcgacggc       720
     aactacatcg taagcggctc catgaaggag accacccgca aggagcttgt cactcatatt       780
     gtcgggcgtg aggtcaaggt cgtcgagaaa gagcgtccga acgcaggtgc tcccatcttg       840
     cttgaagtcc gcaacctgtc ccgcgagagc gaattcaagg acatttcgat ctccgtcgcc       900
     gccggcgaag ttttcggaat ctacggcctc ctcggctccg gccggaccga gttcctggag       960
     gcggtctatg ggatggagac gccgacatcc ggcgaggtga tgcttgcagg aaggccggtt      1020
     ccgcgcggca agccgcgtga atcgatcaag atgggcatgg cgatggtgtc cgaggaccgc      1080
     aaggacagcg gcttggtcct gtcgtcttcg atcgcccaca acatcacgct ttccgccctt      1140
     tccctgatgg cggtcagcgg cttcgtgaag cagcagaagg aacgcgaagt cgtcgaggag      1200
     atgatccgct cccagcggat caagaccagc tcctccgagc ttgcggtcga gaatctgagc      1260
     ggcggaaacc agcaaaaggt cgtcttcgcg cgatgcctga cgaccaatcc ccgacttctg      1320
     atctgcgatg agcccacccg cggcatcgac gaaggctcca agcaggagat ctacgccttc      1380
     ctgcgggact tcgccgccaa gggtcacggt gttctcgtcg tgtcgtccga ggctccggag      1440
     atcctccagg tcagcgacag gatcgcgatt ttcaaggcag gaacgttggt cgacgtcatc      1500
     gacggccatg gcgccaccca gcaaatgatc atggagctcg caagttga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page