(data stored in ACNUC7421 zone)

EMBL: CP001389.PE644

CP001389.PE644       Location/Qualifiers
FT   CDS_pept        710750..711763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24448"
FT                   /db_xref="GOA:C3MIA0"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIA0"
FT                   /protein_id="ACP24448.1"
FT                   /translation="MIIDVAADPAAGITSAVEALGRGDVIAVPTETVYGLAADATNEAA
FT                   VSQIFDIKRRPGFNPLICHCSDLEMVSEFATLDPVSLRLAERFWPGPMTLVLNSNPGRL
FT                   PSVTTAGLTTVAIRIPMGFSNGLIRSYGGPLAAPSANISGRVSATTAAHVESEFGDGVP
FT                   LILDGGPTKIGVESTILRVRENGIELLRPGGLPIELVEHAAGLQVSAPNLFRKVLAPGM
FT                   LTSHYAPRAMVRLNATGVGPGETLLKFGDAIVPGEGACARVFNLSPEGSLEEFAAKLYA
FT                   TLKEADDAGAESIAIVPIPDEGLGLAINDRLRRAAAPRTLTLGELEQAAVRNREAR"
     atgatcattg atgtcgcagc cgatcccgca gcggggatca cttcagctgt cgaggcgctc        60
     gggaggggcg atgtgatcgc ggtgccgacc gagaccgttt acgggttggc cgccgacgcg       120
     actaatgaag ccgcggtatc ccaaattttc gatattaagc gtcgaccggg tttcaacccg       180
     cttatctgcc actgctccga tcttgagatg gtcagcgaat tcgcgaccct ggatccggtc       240
     agtctccgtc ttgcggaaag gttctggccg gggccgatga cgttggtgct caactcgaac       300
     cccggcaggc ttccatccgt gactacggcc ggcctgacca ccgtcgccat cagaattccc       360
     atgggattca gcaatggctt gatcaggtcc tatggagggc cgctggccgc ccccagcgcc       420
     aatatatcgg gaagggtgag tgcgacgaca gcagcgcacg tcgagagcga attcggcgat       480
     ggagtaccgt tgatactcga tggtggccca acgaagatcg gcgtcgagtc cactatcctg       540
     agggtccgcg aaaatggcat cgagttgctt cgtcctggcg gcctgccgat cgagctcgtc       600
     gagcatgctg caggtcttca agtcagcgcc ccaaacctgt tccgcaaagt gctcgcaccg       660
     ggaatgctga catcgcacta tgctccgcgc gcgatggtca ggctgaacgc cacgggcgtc       720
     gggccaggcg agacgctcct caagttcggc gatgccattg ttccgggcga aggggcctgc       780
     gcacgcgttt tcaacctgag tccggagggc agtctcgagg agtttgcggc gaaattgtat       840
     gcgaccctca aagaggccga cgatgccggc gcggaatcca tagcaatcgt tcccataccg       900
     gacgagggct tggggctggc gatcaacgac cgactccggc gagctgcggc gccgcgaacc       960
     ttgacactcg gcgaactcga gcaggcggcg gttcgaaata gggaagccag gtga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page