(data stored in ACNUC7421 zone)

EMBL: CP001389.PE652

CP001389.PE652       Location/Qualifiers
FT   CDS_pept        719162..720943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06630"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06630"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24456"
FT                   /db_xref="GOA:C3MIA8"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIA8"
FT                   /protein_id="ACP24456.1"
FT                   /translation="MSGRSTTWTASIIPARQARADRRRTGGTAASASGNWSRARQTLKQ
FT                   YGVSTFAPSRCRRAGNRDISCREAAVRIGALRERYPEEARVALTPESAVQLRKLGHNCL
FT                   IEAGAGSRSGISDDAYRSVGVEVVPDARALIAASDVVVKVRSPEGDEAKSLNDGQTLIS
FT                   FLWPAQNPDLLETFRDKNITAVAMDMVPRISRAQKMDALSSMANIAGYRAIIEAGNQFG
FT                   RFFTGQVTAAGKVQPAKVLVVGAGVAGLAAIGTAVSLGAIVHAFDVRPEVAEQIESMGA
FT                   NFVFLEFEANQDGAATGGYAAPSSPEFREKQLAKFRALAPEIDIVITTALIPGRPAPKL
FT                   WLEDMVAMMKPGSVIVDLAAERGGNCDLTVPDQRIVSPNGVVIIGYTDFPSRMAAQASI
FT                   LYSTNIRHMLADLTPNKDGVINHNMEDDVIRGATVTKGGEITYPPPPPRIQAIAPAKPK
FT                   EKVREPTAEEMRAAEAAAFRKQTTSQVGLLVIGALLLALIGSYVPSEFMAHIVVFALAC
FT                   FIGFSVIWNVSHSLHTPLMAVTNAISGIVVIGALLQIGSGNWLVVILAALSVLVATINI
FT                   VGGFMVTRRMLAMFQRS"
     atgtcagggc gatcaacgac ctggacagca agtatcatcc ccgcgcgcca agctcgagca        60
     gatagacgtc gaactggggg gacggcggcg agcgcctcgg gcaattggtc acgcgcgagg       120
     caaaccctga agcaatatgg ggtgagcaca tttgctccaa gtcgatgccg tcgagcaggt       180
     aacagagata tctcatgtag ggaggcggca gtgcgtattg gggcattaag agaacggtat       240
     ccagaggaag cgagagtagc gctgactccc gaatctgccg tccaattgag aaaattgggc       300
     cataattgct tgatcgaggc gggagctggg agcaggtcgg gtatttcaga tgatgcatat       360
     cgctccgtgg gcgtagaggt cgtgcctgac gcgagggctc tcatagcagc ttccgatgtc       420
     gtcgtgaaag ttcgcagtcc cgaaggggat gaagcgaaga gcctgaacga tggtcaaacg       480
     ctgatttcct tcctgtggcc ggcccagaac ccggatcttc tcgagacctt tcgggacaag       540
     aacatcacgg ccgttgccat ggacatggtg ccacgcatct cccgtgcaca gaaaatggac       600
     gcgctgtcct ccatggccaa catcgccggg tatcgcgcca tcattgaggc gggcaaccag       660
     ttcggccgct tcttcactgg ccaagtgacg gctgctggca aagtgcagcc ggcaaaggtt       720
     ctcgtagttg gtgccggcgt agctgggctt gcagcgatcg gtacggctgt cagcctcggt       780
     gccatagtac acgccttcga tgttcgtccc gaagtcgccg aacaaatcga aagcatgggt       840
     gcgaactttg tcttccttga attcgaagca aaccaggatg gcgctgcaac gggtggctat       900
     gcggcgcctt cctcgccgga attccgcgag aagcagcttg cgaaattccg agcccttgcg       960
     ccagaaatag atattgtcat caccacggcg ctgatacctg gtcgcccagc tcccaagctc      1020
     tggctggaag acatggtcgc catgatgaag cccggctctg tcatcgtcga cctggccgcc      1080
     gagcgcggcg gcaactgcga tctaaccgtt cccgatcagc gtatcgtctc gccgaacggt      1140
     gtggtcatca tcggctatac cgatttcccg agccgcatgg cggctcaggc ctccatcctc      1200
     tattcgacga acatccgcca catgctggcc gatctaacgc ctaacaagga tggcgtgatc      1260
     aaccacaaca tggaagacga cgttattcgc ggcgcgaccg tgaccaaggg cggcgagatc      1320
     acctatccgc caccgcctcc gaggatccag gccattgccc ccgccaaacc aaaggagaag      1380
     gtgagggagc cgacagcgga agaaatgcgg gccgcggaag ccgccgcctt tcgcaagcaa      1440
     acgaccagtc aggtggggct gctcgttatt ggtgctctgc ttctagcctt gatcgggtcc      1500
     tatgtgccgt ctgagtttat ggcgcacatt gtggtcttcg ctctcgcttg cttcatcgga      1560
     ttctcggtga tctggaacgt aagccattcg ctgcacactc cgctgatggc cgttaccaac      1620
     gcgatctctg gcatcgtggt tatcggggcc cttttgcaga tcggttcggg aaattggctg      1680
     gtcgtgatcc tcgctgcact gtcggttctg gttgccacta tcaatatcgt aggcggcttc      1740
     atggtcaccc gccgcatgct tgccatgttc caaaggtcgt ga                         1782
//

If you have problems or comments...

PBIL Back to PBIL home page