(data stored in ACNUC7421 zone)

EMBL: CP001389.PE653

CP001389.PE653       Location/Qualifiers
FT   CDS_pept        720957..722402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06640"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24457"
FT                   /db_xref="GOA:C3MIA9"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIA9"
FT                   /protein_id="ACP24457.1"
FT                   /translation="MNLGLVSATYLFAAVLFILSLGGLSGQESAKRAVWYGVVGMVLAG
FT                   GATILSPDVSSLSLILPVILVGAALGAIVARRVQMTEMPQLVAALHSFVGLAAVFIGFN
FT                   AHLQLADVAGMDETTREGLTGFAKVLAHKLADPSGVLVSIMKVEVFLGVFIGAVTFTGS
FT                   VIAFAKLAGKIDGKAMKLPGGHVLNAGCAIASVILLGFYFQSNDLWPLAAMTILALFIG
FT                   YHLIMGIGGADMPVVVSMLNSYSGWAAAAIGFTLGNDLLIVTGALVGSSGAILSYIMCQ
FT                   AMNRSFISVILGGFGSTTAPATEIIGEQVAIDADGVAAALNDADSVVIIPGYGMAVAQA
FT                   QGAVSEVTRKLRSKGKNVRFAIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFPE
FT                   TDVAIVIGSNDIVNPAAQEDPNSPISGMPVLECWKAKQVFVSKRGQGTGYSGIENPLFY
FT                   RDNTRMFYGDAKSSLEKLLRLMD"
     atgaatcttg gacttgtatc agcaacctac cttttcgctg ccgttctgtt catcctgtcg        60
     cttggggggt tatcaggcca agagagcgcc aagcgagctg tttggtatgg cgtggtcggg       120
     atggtcctgg ctggcggtgc caccatcctc tcgcccgacg tcagctctct atcgctcatc       180
     cttcctgtca tcctcgtcgg cgctgcgctc ggtgcgattg ttgccaggcg cgtgcagatg       240
     accgaaatgc cccagctcgt cgcagcattg cattcattcg ttggcctcgc tgccgtattc       300
     atcggtttca acgcacatct ccagctagcg gatgtagccg gaatggacga aacgactcgc       360
     gaaggtctga cgggctttgc gaaagttttg gcacacaaac ttgcggaccc gtctggtgtc       420
     ttagtatcga tcatgaaggt cgaggtgttc ctcggcgtgt tcatcggtgc cgtcaccttc       480
     acgggttcgg tcatcgcatt cgccaaactc gcaggcaaga ttgatggcaa ggctatgaag       540
     ttgccggggg gccatgttct caatgccggc tgcgcgatcg cttcggttat cctcttgggg       600
     ttctattttc aaagcaatga tttgtggccg ctcgctgcca tgaccatttt ggctctattc       660
     atcggttatc acctgatcat gggcattggc ggagccgaca tgccagtcgt ggtctccatg       720
     ttgaatagtt actcgggctg ggcagctgcg gccatcggtt ttaccctcgg caacgacctt       780
     cttatcgtca ctggcgctct ggttggctcg tcgggtgcaa tcctttccta catcatgtgc       840
     caggcgatga accggtcctt catctccgtt atcctcgggg gcttcgggag tacgacggct       900
     ccggcgacgg aaataatcgg tgaacaggtg gccatcgatg cagacggagt tgcagctgcc       960
     ctcaatgatg ctgactcagt cgttatcatt ccgggctacg gcatggcggt ggcacaggct      1020
     caaggtgcgg tttcggaagt gacccgcaag ctgcgcagta agggcaagaa tgtacgcttt      1080
     gcaatccatc cagtagctgg ccgtcttccc ggtcacatga acgtgctgct tgcggaagcg      1140
     aaggtgcctt acgacatcgt tcttgaaatg gacgaaatca atgatgactt cccggaaacg      1200
     gacgtggcga tcgtcatagg ctcgaacgac atcgtcaacc ctgcagcaca ggaagacccg      1260
     aactctccaa tctccggaat gccggtgctc gaatgctgga aggcaaagca ggtattcgtg      1320
     tccaagcgtg gccaaggcac tggttactcg ggcatcgaaa atccgctgtt ctacagggac      1380
     aacacgcgca tgttttatgg cgacgccaag tcctcgctcg aaaagctgct tagattgatg      1440
     gattaa                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page