(data stored in ACNUC7421 zone)

EMBL: CP001389.PE654

CP001389.PE654       Location/Qualifiers
FT   CDS_pept        723018..724892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06650"
FT                   /product="putative methyl-accepting chemotaxis receptor"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24458"
FT                   /db_xref="GOA:C3MIB0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB0"
FT                   /protein_id="ACP24458.1"
FT                   /translation="MRDIREFGVALRLSIAFGLLLFAMGVLSLSSIRQVNEINAKLSLI
FT                   NGSNSQKYRNGIDMLGTVRDRAMALRDIVLTDSDTDKATTIAMMKKLQASYASNAAELQ
FT                   KAVNADVFSTAAEHRLVDGLKAFQNEAEPLIAEVIKLTLDGKKDQAKPLLLNQLRPKLT
FT                   AWIGALNKLIDYEQALNQGVGGKVKAASDEFKSLTLTALSVAALFGIFAAALTTRSIIA
FT                   PLAKLQQSVRQMIAGDMQIDRVIERRMDEIGQLARQISSLKTHLSEKAERDAVAEHHRQ
FT                   DAERQRLETEGEERQRAAEQTSSAVEQVAEALKQLSKGNLHIQLDRPFTEALEPLRLDF
FT                   NSAISQLRDAMFEVNYNAQAIAAGAEEIRTSSSELATRTEQQALVVEQTASVLADMTRQ
FT                   VVDASHRAHEAGVLVGETKENVERSGTIMRDAVEAMTKIRASSLEIGDIIGVIDEIASQ
FT                   TNLLALNAGIEAARAGETGRGFAVVAQEVRDLAQRSAAAAKEIKSLVEVSNLHINDGVQ
FT                   RVHQAGDALGQIVVQVQSVNQNVDAIAQVSRTQADGLKDINFSVEKIESATQQNAAMVE
FT                   ESTAAVHNLAKEAASLFEMLSRFQMDDGPADTKRVEESAFSVAVASSA"
     atgcgcgata ttcgggaatt tggcgtggcg ctacgtttgt cgatcgcttt cgggttgctg        60
     ttgttcgcaa tgggagttct gtccctttcg tcaatcaggc aggtgaatga gataaacgct       120
     aagctcagcc tcataaatgg cagtaacagc caaaaatacc ggaacggcat tgatatgctc       180
     ggaacggtcc gtgatcgagc aatggcattg cgcgacatcg ttttgaccga ctcagatacg       240
     gataaagcga cgacaatcgc gatgatgaaa aagctgcagg cgtcctatgc ctccaacgct       300
     gcggaattgc agaaggccgt gaatgctgat gtcttcagca ctgccgctga gcatcgtctt       360
     gttgatggtc tgaaggcatt tcagaatgaa gcggaaccac taatcgccga agttatcaag       420
     ctgacactgg atggaaaaaa agaccaggca aagccactcc tcttaaatca acttcgaccc       480
     aagttgacgg catggattgg tgctttgaac aaattaatcg attacgagca agcattaaac       540
     cagggcgtag gcggcaaagt caaggcggct tctgacgagt ttaagtccct gaccctcact       600
     gcgctaagtg tggctgcttt gttcgggata tttgcggcag cgctcactac ccgctcaatc       660
     atagcgcctc tggcgaagct gcagcagtca gtccgtcaaa tgatagcggg cgacatgcag       720
     attgaccgag taattgagcg acgaatggat gaaatcggcc agctagctag gcagatatcc       780
     agccttaaga cccatctctc agaaaaagct gagcgcgatg cggttgccga acatcatcga       840
     caggatgctg agcggcagcg tttggagacg gaaggggaag agcgccagcg ggctgccgaa       900
     cagactagtt cagccgtcga gcaagttgcc gaagctttga aacaattgtc gaaaggcaat       960
     cttcacattc agctcgatcg gcctttcacg gaagctcttg agccgctcag attggacttc      1020
     aattcagcga tcagccagct tcgtgatgcg atgttcgagg tgaactataa cgcgcaggcg      1080
     attgctgcgg gtgctgagga aatccgtact tcctcgagcg agctcgcgac caggacggag      1140
     cagcaagctt tagttgttga gcaaacggcg tcggtcctcg cagatatgac aaggcaggtg      1200
     gtggacgcaa gccatagggc acacgaagca ggggtcctgg tcggtgaaac caaagagaat      1260
     gtcgagaggt caggcactat aatgcgcgat gctgttgagg ctatgacgaa aattcgggcc      1320
     tcgtcgcttg aaataggcga tatcatcggc gttatcgatg aaatcgcgtc tcagacaaac      1380
     ctgttggcgt tgaacgcagg cattgaggca gctcgtgctg gtgagactgg ccgtgggttt      1440
     gcggtggttg cgcaggaggt cagagacctg gcacaaaggt ctgcggcggc cgcgaaagaa      1500
     atcaagtcct tggttgaggt atctaaccta catataaatg atggggtcca gcgcgtgcac      1560
     caagccggcg atgcgttggg ccaaatcgtt gttcaggtgc agagtgttaa ccaaaacgtc      1620
     gacgccattg ctcaagtttc tcgcactcaa gccgacgggc tcaaggacat caatttctca      1680
     gtagaaaaaa ttgaatcagc gacacaacaa aacgcagcga tggtggaaga gtcgaccgct      1740
     gccgtccaca atctcgcgaa agaggcagcc tcgcttttcg agatgttatc caggttccag      1800
     atggacgacg ggccagcaga caccaagcgc gtagaagagt cagcgttctc tgtggccgta      1860
     gcatcgtcgg cgtga                                                       1875
//

If you have problems or comments...

PBIL Back to PBIL home page