(data stored in ACNUC7421 zone)

EMBL: CP001389.PE656

CP001389.PE656       Location/Qualifiers
FT   CDS_pept        726251..727471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06670"
FT                   /product="sugar ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24460"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB2"
FT                   /protein_id="ACP24460.1"
FT                   /translation="MKRLLCVATAVAMFLPVAVRAEEARVIHWWTSGGESDAIKVIADA
FT                   YKSDGGTWIDQAIAGSDSARLAATNAISGGQPPTMAQFNISNQFRELAEASFLRSLDDV
FT                   AADENWQAVLPGPILDVITVDGHIYAAPVNIHNPAWIWYSTEALQKAQVSEPPTTKNAF
FT                   FTALDKLKSAGIIPLALGGQPWQERATFDAVLLHFGGKDMYMNFIGGNGAALVQTPEFK
FT                   QVLADFKRLKGYVDEGSPNRSWNEATALVIENKAGFQIMGDWAKGEFKAAGDTAGKEYG
FT                   CIVGFGDKPSYMIAGDVFIFPKSNESDTAAQTHLAKLMLSPKVQVDFNNLKGSIPVRAG
FT                   VDGSNMDVCAQAGLAAVSDPSRQVPNPEMRLSPDAHGMVTDAISNFWNTDQSVDEAVAA
FT                   LQSALSM"
     atgaagagac tgctttgtgt ggcgacggct gttgcgatgt ttctgcctgt cgcagtgcgg        60
     gctgaggagg ccagggtcat ccactggtgg acgtcgggcg gggaatccga cgcgatcaag       120
     gtcatcgccg acgcttataa gtcggatggc ggcacctgga tagatcaggc catcgcgggg       180
     tcggactcgg ctcggctcgc cgccaccaat gcgatctccg gtgggcagcc gccgacgatg       240
     gcgcaattca acatttccaa ccagttccgt gaacttgccg aggcaagctt cctgcgcagc       300
     ctcgatgatg tggcggcaga cgagaactgg caagcggttc ttccagggcc aatcttggat       360
     gtcatcacgg tcgacggtca catctatgcg gcgccggtga acatccataa tcccgcttgg       420
     atctggtact cgacggaggc gttgcaaaaa gctcaggtct ccgaaccgcc gacgacgaag       480
     aacgcgttct tcaccgccct ggacaagctg aaatcggccg gaatcatccc tttggctctc       540
     ggcggccagc cgtggcagga gcgcgcgact ttcgacgcag ttctcctgca cttcggcggc       600
     aaggacatgt acatgaactt catcggcggc aatggcgcag ccttggtcca gacgcccgag       660
     ttcaaacaag tcctcgccga tttcaagcgc ctgaaaggct atgtggacga gggatcgccc       720
     aatcgtagct ggaacgaggc gactgcactt gttatcgaga acaaggctgg tttccagatc       780
     atgggggact gggccaaggg tgaattcaag gccgccggcg acaccgccgg gaaggaatac       840
     ggttgtatcg tggggttcgg cgacaagccc tcgtacatga tcgcaggcga cgtcttcatt       900
     ttcccgaagt cgaacgaatc cgacaccgcc gcgcaaacgc acctcgccaa gctgatgctc       960
     tcgccgaagg ttcaggtgga tttcaataac ctaaaaggct ccatcccagt gcgggcgggc      1020
     gtggacggct cgaatatgga tgtctgtgcg caggccgggc ttgccgctgt ctccgatccg      1080
     tcgcgccagg ttccgaatcc cgagatgcgc ctgtcgccgg acgcacatgg catggtgaca      1140
     gacgcgattt cgaacttctg gaataccgac caatcggtcg atgaagctgt ggccgcgctg      1200
     caaagcgcgc tgtcgatgta g                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page