(data stored in ACNUC7421 zone)

EMBL: CP001389.PE658

CP001389.PE658       Location/Qualifiers
FT   CDS_pept        728467..729330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06690"
FT                   /product="hypothetical ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24462"
FT                   /db_xref="GOA:C3MIB4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB4"
FT                   /protein_id="ACP24462.1"
FT                   /translation="MAYDNHPPQVRFAIYAVLVVAGIFYFLPIYVMIATSLKSMSEIRD
FT                   GSIFALPAAPSIDAWVRAWTSACTGLNCTGIRVGFWNSVSIVTPSVIVSIFFGALNGYA
FT                   LSFWRPRGGVWLLCGLLLGAFIPYQIFLFPLTKILVAVGLFKTLTGLVFVHTLFGMPIM
FT                   TLLFRNYFASVPSDLFNAARVDGAGFFAIFFFVMLPMATPIVIVAVIMQITAIWNDFLF
FT                   GLVFANSDRVPMTVQLNNIVNSTTGEREYNVNMAATILTSLVPVAVYLLSGKYFVRGIA
FT                   AGAVKG"
     atggcctacg acaaccatcc accccaggta aggttcgcaa tctatgccgt cctcgtggtc        60
     gcgggcatct tctactttct accgatctac gtgatgattg ccacgtcgct gaaatccatg       120
     tccgaaatcc gggacgggag catcttcgca cttcccgcgg cgcccagtat cgacgcttgg       180
     gttagggcct ggacgtcggc ctgcacgggt ctgaactgca cgggcatccg ggtcgggttc       240
     tggaactcgg tgtcgattgt aacgccttca gtaatcgtct ccatcttctt tggcgcgctg       300
     aacggctatg ccctcagctt ctggcggcca aggggcggcg tttggctgct ctgtggcctg       360
     ctgcttggag ctttcatccc ctaccagatc tttctcttcc cattgaccaa gatcctggtg       420
     gcggtcggtc tgttcaagac cctgacgggc ctcgtgttcg tccatactct gttcggaatg       480
     ccaataatga cgctgctgtt tcggaactat tttgcctccg ttccaagcga tctgttcaat       540
     gccgcaaggg tcgatggtgc aggcttcttc gccatcttct tctttgtaat gttgccgatg       600
     gcgacaccca tcgtaatcgt cgccgtgatc atgcaaatca cggcgatttg gaatgatttc       660
     ttgtttggcc tggttttcgc aaattctgac cgcgttccaa tgaccgtcca gctcaacaac       720
     atagtcaatt cgacgacggg ggagcgggaa tacaacgtga acatggccgc aaccattctg       780
     acctcgctgg ttccggtcgc cgtgtattta ctttccggaa aatacttcgt gcgcggcatc       840
     gccgctggcg cggtgaaagg ctga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page