(data stored in ACNUC7421 zone)

EMBL: CP001389.PE659

CP001389.PE659       Location/Qualifiers
FT   CDS_pept        729334..730401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06700"
FT                   /product="hypothetical ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06700"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24463"
FT                   /db_xref="GOA:C3MIB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB5"
FT                   /protein_id="ACP24463.1"
FT                   /translation="MTKNVSVKKLNIGYGAYTIVKDLDLDIAAGEFLVLLGPSGCGKST
FT                   LLSAFAGLAPVQSGAIHFGDRDVTRLAPKDRGVGMVFQSYALYPTMSVRRNISFGMKMA
FT                   GIRAAERERKVNEVADFLQISALLDRKPSQLSGGQRQRVAIGRALARDADIYLFDEPLS
FT                   NLDAKLRTELRYEIRRLHSELGSTMIYVTHDQIEAMTLATRIAVMKSGVIQQLDRPNEI
FT                   YLRPANLFVAGFVGSPAMNLIKGRIDRAAGGGSIFVSAGFSLELKARYQSQEAILGVRP
FT                   EQFVSRDGPIKGKIEMTEDMGPDALFWLTVGGQRLSIRSSSSSLPQPGSEFSANVDQDV
FT                   ISLFSAESGVRLAAA"
     atgaccaaga acgtctctgt gaagaaacta aacatcggct atggcgccta cacgatcgtt        60
     aaggacctgg acctcgatat tgcggcgggc gagtttctgg tgttgctcgg cccttcgggc       120
     tgcggcaagt ctacattact atcagccttt gccggcctcg ccccggtgca aagcggcgcc       180
     atccacttcg gagaccgcga cgtgacacgc cttgccccaa aggatcgagg cgtgggcatg       240
     gtctttcagt cctacgcgct ctatccgacc atgtcggtgc gcaggaacat cagtttcgga       300
     atgaagatgg ccggaatcag ggcggctgaa cgcgagcgca aggtcaacga ggtggcggac       360
     ttcctgcaga tttccgccct gctcgaccgc aagccttcgc aactctccgg cggacagagg       420
     cagagggtgg cgatcggtag ggcgcttgca cgcgatgccg acatctatct gttcgacgag       480
     ccgctatcga acctcgacgc caagctacgc accgagctgc ggtacgagat ccggcggctg       540
     cactcggaac ttggctcgac gatgatctac gtaacgcacg accaaatcga agcgatgacg       600
     ctggcaaccc ggattgcggt catgaagtcg ggcgtgattc agcagttgga tcgcccaaac       660
     gaaatttatc tgcggccagc aaatcttttc gtagcgggtt tcgtcgggtc accggcgatg       720
     aacttgatca aggggcggat cgacagggcg gccggagggg gctcgatctt cgtttcagcc       780
     ggcttcagtc tggagctgaa ggccaggtat cagtcgcaag aggcgatttt gggcgtcaga       840
     cccgaacagt tcgtaagtcg cgatggcccc atcaagggca agattgaaat gactgaggac       900
     atggggcccg atgcgctttt ctggttgacg gtcggtggcc agcggctgtc catccggtcc       960
     agttcctcat cgctgcccca gcccggctcg gagtttagcg caaacgtgga ccaggacgtg      1020
     atttcgctct tttctgcgga aagcggagtg aggcttgccg ccgcctga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page