(data stored in ACNUC7421 zone)

EMBL: CP001389.PE66

CP001389.PE66        Location/Qualifiers
FT   CDS_pept        complement(71654..73555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00660"
FT                   /product="DEAD/DEAH box protein, ATP-dependent RNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23870"
FT                   /db_xref="GOA:C3MF33"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF33"
FT                   /protein_id="ACP23870.1"
FT                   /translation="MTEFEGIAPAIAEALAKRGYNTLTPVQQAMLDPALEGADALVSAQ
FT                   TGSGKTVAFGLALGPTLLGPARQFDSPGAPLALVIAPTRELALQVKRELEWLYEITGAT
FT                   IASCVGGMDIRSERRALERGAHIVVGTPGRLCDHIRRDSLDISALRAIVLDEADEMLDL
FT                   GFREDLEFILEASPTERRTLMFSATVPRSIATLAKNYQRDAVRIGVASEQKQHGDIEYR
FT                   SLLVAPSDRENAIINVLRYYDARNAIVFCSTRAAVNHLTARFNNRGFSVVALSGELSQN
FT                   ERNHALQAMRDGRARVCIATDVAARGIDLPGLELVIHADLPTNPDTLLHRSGRTGRAGQ
FT                   KGVSALIVPVNQRRKAERLLDGARITATWAKPPSAEDVTGRDDERLIADAAFDEPLRDD
FT                   EQTIVQALIDRHGAEKLAAAFVRQFRSSRSAPEELSDVPLFDDRKKARRDAPAFTGDSA
FT                   AAPRADFTDGQWFSLSVGRKQNAEPRWLIPMLCRHGKLSKRDIGAIRMQPEETYVELTA
FT                   DGAERFLTAIGPNRTLEKGIRVKTLPGAPDGSRPRDDKPEFAKKRPRPAEAQPERGQKD
FT                   FQPKRKFEKKPPVSQDTNPEKRDEKPWSKKKGKPDARKAAGDFKPKAKRNNAKNRQA"
     atgacagagt tcgaagggat cgcaccggcg atcgccgagg cgttggcgaa acgcggttac        60
     aacaccctga caccggtcca gcaggccatg ctcgacccgg cgctcgaggg cgccgacgcc       120
     ctggtttccg cccagaccgg ctccggcaag accgtcgcct tcggcctggc gctcgggccg       180
     acattgctcg gaccggcgag gcagttcgat tcacccggcg cgccgctggc gctcgtcatt       240
     gcgccgacgc gcgaactggc gctgcaggtt aagcgcgagc tcgaatggct ctacgagatc       300
     acgggagcga cgatcgcgtc ctgcgtcggc ggcatggata tccgcagcga gcggcgcgcg       360
     ctcgaacgcg gcgcccatat cgtcgtcggc accccgggcc ggctctgcga ccatatccgc       420
     cgcgactcgc tcgacatctc cgcgcttcgc gcgattgtcc tcgacgaagc cgacgaaatg       480
     cttgacctcg gcttccgcga ggatctggag ttcattctcg aagcgtcgcc gaccgagcgc       540
     cgcacgctga tgttctcggc aaccgtgccg cgctcgatcg cgacgctcgc gaagaactac       600
     cagcgcgacg cggtgcgcat cggggttgcc tccgaacaga agcagcacgg cgacatcgaa       660
     taccgatccc ttctcgtcgc gccgagcgat cgggaaaacg ccatcatcaa cgtgcttcgt       720
     tactacgacg cccgcaatgc gatcgtcttc tgttcgaccc gcgccgcggt taaccacctg       780
     accgcccgct tcaacaatcg cggcttctcg gtcgtggcgc tctcgggcga actcagccag       840
     aacgaacgca atcatgcgct tcaggcgatg cgcgacggcc gcgcccgggt ctgcatcgcg       900
     accgatgtgg cggcgcgcgg tatcgacctg ccgggcctcg agctcgtcat ccatgccgac       960
     ctgccgacca atccggacac gctgctgcac cgcagcggcc gcaccggccg cgccggccag      1020
     aagggcgtca gcgcgttgat cgtgccggtc aaccagcggc ggaaggcgga gcgactgctg      1080
     gatggcgctc gcatcaccgc cacctgggca aagccgccgt cggcagaaga cgtcacaggc      1140
     cgcgacgacg agcgtctcat cgccgatgcg gccttcgacg agccgctgcg cgacgacgaa      1200
     cagacaatcg tccaggcgct gatcgatcgc catggcgccg agaagctcgc cgccgccttc      1260
     gtgcggcagt tccgctcgag ccgttccgcc cccgaggagc tttccgacgt ccccctcttc      1320
     gacgaccgca agaaagcccg ccgcgacgcc ccggctttca ccggcgacag cgccgccgcg      1380
     ccgcgcgcgg acttcaccga cgggcaatgg ttctcgctct cggtcgggcg caaacagaat      1440
     gccgaaccgc gctggctgat cccgatgctc tgccgccatg gcaagctcag caaacgcgac      1500
     atcggcgcaa tccgcatgca gccggaggaa acctatgtcg aactgacggc cgacggcgcc      1560
     gagcgcttcc tcacggcgat cggcccgaac cggacgctgg agaagggcat tcgcgtcaag      1620
     acgctgccgg gcgccccgga cggctcgcgg ccgcgcgacg acaagccaga attcgcgaaa      1680
     aagcggccgc ggccggcaga ggctcagccg gagcgcggcc aaaaagattt tcagccgaaa      1740
     cgcaagttcg aaaagaagcc tcccgtcagc caggacacga atccggagaa gcgggacgaa      1800
     aagccctgga gcaagaagaa ggggaagcct gacgcaagga aggcggccgg cgacttcaag      1860
     ccgaaagcca agcgcaacaa cgccaagaac cggcaggctt ga                         1902
//

If you have problems or comments...

PBIL Back to PBIL home page