(data stored in ACNUC7421 zone)

EMBL: CP001389.PE661

CP001389.PE661       Location/Qualifiers
FT   CDS_pept        complement(733347..733625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24465"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB7"
FT                   /protein_id="ACP24465.1"
FT                   /translation="MFEIGAAGSMSGPGTRKRQPKNPVAADEIVSEAIASSKAGGRFRV
FT                   GGTRPSGSDFERGSETGNLALVEAATTAIEAAGGRVASTAEARRIIA"
     ttgttcgaaa tcggcgccgc aggatctatg agcggaccag ggacccgtaa gcgccagccc        60
     aagaatccag tcgccgcgga tgaaatcgtc tcggaggcaa ttgcgtccag caaggctggc       120
     ggacgttttc gcgttggggg gacacgtccg agcgggtcag atttcgaacg cggctcggaa       180
     acgggaaacc tcgccttggt ggaggcggcg acgacggcga tcgaagctgc cggaggaaga       240
     gtggcttcaa cagcggaggc gcgaaggatc atcgcctag                              279
//

If you have problems or comments...

PBIL Back to PBIL home page