(data stored in ACNUC7421 zone)

EMBL: CP001389.PE662

CP001389.PE662       Location/Qualifiers
FT   CDS_pept        complement(733637..734464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24466"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR031663"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037161"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB8"
FT                   /protein_id="ACP24466.1"
FT                   /translation="MTAVALFGAGGKMGCRLTKNLKGSRFDVRHVEVSAGGKARLEREL
FT                   GIGTVDVDQALDGVDVVILAVPDTAIGKVASSIEAKLRPGTMVIALDAAAPAAGHLPDR
FT                   PDLTYFVTHPCHPPIFNDETDPHAKRDFFGGVAAKQHIVSALMQGPEEHYALGEEIAKV
FT                   IWAPVMRSHRVTVEQIALLEPGLSETVCASLLVVMRQAMDECVARGVPKEAARDFLLGH
FT                   LNVLGAVIFEETPGVFSDACNKAIEFGIPALMKDDWKKVFEPKEIADSIRRIT"
     atgactgcgg ttgcgctgtt cggggctggt ggaaaaatgg gatgccgcct gacgaaaaat        60
     ctcaagggct cgcggttcga cgttcgccac gtcgaggtga gcgccggggg caaggctcgc       120
     cttgagagag agcttggcat cggcaccgtt gatgtcgatc aggcacttga cggcgtcgac       180
     gtggtcatat tggccgtccc ggacacggca ataggcaaag tggcctcgag cattgaggcg       240
     aaactccggc cgggcacgat ggtgatcgcg ctcgacgccg cggctccggc ggccggacac       300
     ctgccggatc gtccggacct cacatacttc gtcacccatc catgccatcc tccgatcttc       360
     aacgacgaga cggacccgca cgcgaagcgc gatttcttcg gaggggtggc ggccaagcag       420
     cacatagtct ccgcgctgat gcaaggcccc gaagagcact atgctcttgg ggaagagata       480
     gccaaagtga tctgggcacc tgtcatgcga tcgcaccggg tcacggttga acaaatcgcc       540
     ttgctcgaac ccggcctgtc ggaaaccgtc tgcgcctcgc tccttgtcgt catgcgccag       600
     gccatggacg aatgcgtcgc gcggggagtc ccgaaggaag cggctcggga tttcctgctc       660
     ggccacctga acgtcctggg cgcggtcatt ttcgaggaaa cgcctggcgt cttctcagac       720
     gcgtgcaaca aggcgatcga atttggcatc cctgctctga tgaaggacga ctggaagaaa       780
     gtattcgaac ccaaggaaat cgcggacagc atccggcgca tcacctga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page