(data stored in ACNUC7421 zone)

EMBL: CP001389.PE663

CP001389.PE663       Location/Qualifiers
FT   CDS_pept        complement(735090..735671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24467"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB9"
FT                   /protein_id="ACP24467.1"
FT                   /translation="MPNSYDPNRISALRALSKSGDDNGFRKAVDLHTERGLPIEEIQQA
FT                   IHASEWRYVVEGCGTSVALERRSELLGYYDDMLEHIEDALSTMTDLDDVRGGPKGMLRH
FT                   LEEREALGKDCFEALLEGRRVLQYLLPEDDLPDPKHDIGRLLSKSGFLWDGAYEVEKVP
FT                   GENEQIFNEAVKIMEYMLSTWSASRPVEEE"
     atgccgaata gctatgaccc aaatcgtatc tccgcgcttc gcgcgctatc aaaaagcggc        60
     gacgacaatg ggtttcgaaa ggccgtcgac ttgcatactg agcgtggact tccgatcgag       120
     gaaatccagc aagccatcca tgcgagcgaa tggcgctatg tcgtcgaagg atgcgggaca       180
     tccgtcgcat tggagcgtcg ttccgaactg ctcggctact acgatgacat gctcgagcat       240
     atcgaggatg ccttgtcgac aatgactgac ctcgatgatg tgagaggcgg acccaagggc       300
     atgctacgcc atctggaaga acgcgaagca ctcggcaagg actgtttcga ggctctcctt       360
     gaggggcggc gtgtcctcca atacctcttg ccggaggatg accttcccga tccgaaacac       420
     gatatcggtc gactgctgtc caaatccggt ttcctatggg acggcgccta tgaagtcgaa       480
     aaggtccctg gagagaacga gcagatcttc aacgaagcgg tcaagatcat ggaatacatg       540
     ctcagcacct ggtcagcttc tcgtccagtc gaagaagaat ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page