(data stored in ACNUC7421 zone)

EMBL: CP001389.PE67

CP001389.PE67        Location/Qualifiers
FT   CDS_pept        complement(73709..74065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23871"
FT                   /db_xref="GOA:C3MF34"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF34"
FT                   /protein_id="ACP23871.1"
FT                   /translation="MTWLFFSPSGRIGRLPFFLSWLLWLVLGGIILMQMLKYEDQDAAL
FT                   ALWTLAMIGSGVASTVSIAMLAIKRLHDIGYPGPLALCLFIPVLSPIVFIALCLWPGAP
FT                   GANEFGGHRNGPRR"
     atgacctggc tgttcttcag cccctccggc cgtatcggtc gcctgccctt cttcctctcc        60
     tggctgctct ggcttgtcct cggcggcatc atcctgatgc agatgctgaa atatgaggat       120
     caggacgcgg cgctggcgct ctggacgctg gcgatgatcg gctccggcgt tgcctcgacc       180
     gtctccatcg ccatgctggc gatcaagcgg ctccatgata tcggctatcc cggcccgctg       240
     gcgctctgcc tcttcatccc ggtgctgagc cccatcgtct tcatcgctct ctgcctctgg       300
     cccggcgcgc caggtgccaa cgaattcggc gggcaccgca acggccccag gcgctga          357
//

If you have problems or comments...

PBIL Back to PBIL home page