(data stored in ACNUC7421 zone)

EMBL: CP001389.PE69

CP001389.PE69        Location/Qualifiers
FT   CDS_pept        75258..76157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00690"
FT                   /product="conserved hypothetical protein, possible lysine
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23873"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF36"
FT                   /protein_id="ACP23873.1"
FT                   /translation="MGRMKKRSLRGKGGVWDPLADSSQSRQRASTVPLTPQSASPTYRL
FT                   AYIDDDFLCREELRPVRLQLELLKTEMMLEERGINSTVVMFGGARIPEPGGEAWAAKNE
FT                   TQRKNLEAASVYYDEARKFARLCSEQSAKLGHKEYVIVTGGGPGVMEAGNRGAADVGAP
FT                   SIGLNIVLPHEQAPNSYVTPELSFNFHYFAIRKMHFLLRAKAVAVFPGGFGTLDELFET
FT                   MTLMQTGRLALVPLVLFGEKFWRSIINFEALAEFGTIAPNDIDLVHFVETAEEAWEIIA
FT                   RFYETVDPRSVPMASGRR"
     atgggacgca tgaagaagcg cagtttgcgc ggcaagggcg gtgtctggga tccgctggca        60
     gacagctcgc aaagcaggca gcgcgcctcg accgttcccc tgacgccgca atcggcctcc       120
     ccgacctacc ggctcgccta tattgacgat gatttcctct gccgggagga attgcggccg       180
     gtgcgcctgc agctcgagct cctgaagacg gagatgatgc tcgaggagcg cggcatcaac       240
     tcgaccgtcg tcatgttcgg cggcgcgcgc attcccgaac cgggcggcga ggcctgggcg       300
     gccaagaacg agacgcagcg caagaacctg gaagcggcct cggtctatta cgacgaagcc       360
     cgcaagttcg cgcggctctg ttccgagcag tccgccaagc tcggccacaa ggaatatgtg       420
     atcgttaccg gcggcgggcc gggcgtcatg gaggccggaa accgcggtgc tgcggatgtc       480
     ggcgcgccgt cgatcggcct caacatcgtt ctgccgcacg agcaggcgcc gaacagctac       540
     gtcacgcccg aactctcctt caacttccac tatttcgcca tccgcaagat gcatttcctg       600
     ctgcgcgcca aggcggtggc ggtcttcccg ggcggcttcg ggacgctcga cgagctgttc       660
     gagaccatga cgctgatgca gaccggccgc ctggcgctcg taccgctggt tctgttcggc       720
     gagaaattct ggcgctcgat catcaatttc gaggcgcttg ccgagttcgg cacgatcgcg       780
     ccgaacgata tcgatctcgt gcatttcgtc gaaaccgccg aagaggcttg ggagatcatc       840
     gcccgttttt acgaaacggt ggatccgcga tcggtgccga tggcctccgg ccggcggtaa       900
//

If you have problems or comments...

PBIL Back to PBIL home page