(data stored in ACNUC7421 zone)

EMBL: CP001389.PE71

CP001389.PE71        Location/Qualifiers
FT   CDS_pept        77052..77966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00710"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23875"
FT                   /db_xref="GOA:C3MF38"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF38"
FT                   /protein_id="ACP23875.1"
FT                   /translation="METWVLITVAAAFLQNIRSSMQKHLKGAMGTTGATFVRFGFGLPF
FT                   ALLYLLMLWRVAGHPLPVPNATFFLWAAVGGMAQIAATFLLVHLFSFRNFAVGTAYSRT
FT                   EPAQAALFGLIFLGEKASQGTLVAIAISVVGVMLISVARTTLSTRSLLTSVFSPTAAIG
FT                   LFSGTFFGLSAVSYRSASLALAPSLPAPDFMMQASFTLGFVILLQTAVMLLWIVAREPD
FT                   ELKRIGSAWKPAFVVGFVGSSASFGWFMAMTLQQAAIVKVVAQVEMIFTFASSFFIFRE
FT                   WINRLELVGCLLIVLGVVMLLVL"
     atggaaacct gggttctcat caccgtcgcc gccgcctttc tgcagaatat ccgctcctcc        60
     atgcagaagc acctgaaggg tgccatgggg acgaccggcg ccaccttcgt gcgcttcggc       120
     ttcggacttc ccttcgcgct cctctacctt ctgatgctct ggcgcgtcgc cggccacccg       180
     ctgccggtgc cgaacgcgac cttcttcctc tgggctgccg tcggcggcat ggcgcagatc       240
     gccgcgacat tcctgctcgt gcacctgttc tccttccgca acttcgctgt cggaaccgcc       300
     tattcccgca ccgagccggc ccaggcggcg ctcttcgggc tgatcttcct cggtgagaag       360
     gcaagccagg ggacgctcgt ggcgatcgcc atctcggtgg tcggcgtcat gctgatttcc       420
     gttgcccgca cgacgctcag cacccgctcg ctgctgactt cggtcttcag ccctaccgcc       480
     gcgatcggcc tgttctccgg caccttcttc gggctctccg cggtttccta ccgctcggct       540
     tcgctggcgc tggcacccag cctgcccgcg cctgacttca tgatgcaggc gagcttcacg       600
     ctcggtttcg tcatcctgct gcagaccgcc gtcatgctcc tctggatcgt cgcacgcgag       660
     cccgacgaac tgaagcgcat tggttcggcg tggaagcccg ctttcgtcgt cggcttcgtc       720
     ggctcgtccg cgtccttcgg ctggttcatg gcgatgacgc tgcagcaggc ggcgatcgtc       780
     aaggtcgttg cgcaggtcga gatgatcttc accttcgcct cgtccttctt catcttccgc       840
     gaatggatca accggctcga actcgtcgga tgcctgctga tcgtgctcgg cgtcgtgatg       900
     ctgctggtcc tttag                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page