(data stored in ACNUC7421 zone)

EMBL: CP001389.PE73

CP001389.PE73        Location/Qualifiers
FT   CDS_pept        complement(79080..80282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00730"
FT                   /product="integrase catalytic core domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23877"
FT                   /db_xref="GOA:C3MF40"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF40"
FT                   /protein_id="ACP23877.1"
FT                   /translation="MVWRETGIMEERLKFVAACLSGEETMAGLCALYGISRKTGYKWLR
FT                   RFQLRGPAGLEDLPRAPLNHGRATAAELVERIVAEKEAHPLWGPKKIVARLARQDPATA
FT                   WPSASTAGAILNRHGLVGRRRARWKGAGNGPWPEPAMPNAVWTGDHKGWFTTRDGWRCE
FT                   PLTVMDVKSRYLLALEATGSTGDEEAWPVFERLFDEHGLPDRIRTDNGPPFAAAGVTGL
FT                   TPLSLRFVRLGITLERIAPGKPQQNGKHERFHLTMLPLAKAPAADRAAQAEAFEAFRRE
FT                   YNEERPHETLGMDTPAEHYRASTRKMPVSPPEPDYPAEAAVRKVRHNGAVKWQGAEIYV
FT                   SATLVGEVVAIEETESGEWAMRFYAHRLGFIDEKRGRLVRKTVLQPRPAVGLADELREE
FT                   L"
     atggtttgga gagagactgg catcatggag gagcggctga agtttgttgc ggcatgtttg        60
     tccggcgagg agacgatggc tgggctttgc gcgctctacg ggatatcgcg caagacgggc       120
     tataaatggc tgagacgctt tcagctgcgc ggtcctgcgg ggctggagga tctgccgcga       180
     gcaccactta accacgggcg ggcgacggcg gcagagctgg tggagcggat cgtggcggag       240
     aaggaagcgc atccgctatg gggtccgaag aagatcgttg cgcggctggc gcgacaggac       300
     ccggcgacgg cttggccgtc ggcttcaacg gcgggagcga tccttaatcg gcacgggctg       360
     gtcgggcggc ggcgcgcccg gtggaagggg gccggcaacg gcccttggcc ggagccggcg       420
     atgccaaatg cggtatggac gggcgaccac aaaggctggt tcacgacccg cgacggctgg       480
     cgctgcgaac cgctgacggt gatggatgtc aaaagccgtt atctgctggc gctggaggcg       540
     accggctcga ccggtgacga agaggcctgg ccggtgttcg agcggctgtt tgacgagcat       600
     ggcctgcccg accgcatcag gaccgacaac ggtccgccct tcgcggcggc cggtgtcacc       660
     ggactgacgc cgctatccct acgcttcgtg cggctgggga ttacgctgga gcgcattgcg       720
     ccaggtaagc cgcagcaaaa cggaaagcac gagcgcttcc atctgaccat gctgccgctg       780
     gcaaaagcgc cggcagccga ccgggccgcg caggccgaag ccttcgaagc gtttcggcgt       840
     gagtacaatg aggagcgacc gcacgagacg ctcggcatgg acacgccggc cgagcactac       900
     cgggcatcga cgcgcaaaat gccggtcagc cctccggaac ccgattatcc ggccgaggcc       960
     gcggtgcgca aggtgcgcca caacggcgcc gtcaaatggc agggcgcgga gatttacgtc      1020
     tcggccacgc tggtcggaga ggtggtcgcc attgaggaga cggagagcgg cgaatgggcg      1080
     atgcgcttct acgcccatcg cctcggcttt atcgacgaga aacgcggcag gctcgtccgc      1140
     aaaaccgtct tgcaaccccg accagccgtc ggtcttgcgg acgagctacg ggaagaactg      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page