(data stored in ACNUC7421 zone)

EMBL: CP001389.PE76

CP001389.PE76        Location/Qualifiers
FT   CDS_pept        82146..82865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23880"
FT                   /db_xref="GOA:C3MF43"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF43"
FT                   /protein_id="ACP23880.1"
FT                   /translation="MTTQKPESGDSRRDEVIAGEYVLGVLSAEDRRQVEARMATDRNFA
FT                   AMVVRWQSNLAHIDMAYEPVTPPPHVFAAIESRVFESPASPKKSAGLWNSLSFWRSLAI
FT                   ASLAAVAVLGISMLELFSAGQGGKPLVAELQGQGNGLGLALVAQFDIGTGRLRVTPVAA
FT                   RQAEEKSLELWLIKGSDPAISLGVLPQSGEGEIRVSPAVRSKITEGSTLAVSLEPLGGS
FT                   PTGAATGPVIALGTTRR"
     atgacgaccc agaagcccga aagcggggat tcccgccgcg acgaagtgat cgcgggggaa        60
     tacgtgctgg gtgttctgtc tgccgaggac cgccgccagg tcgaggcgcg catggcaacc       120
     gatcgcaatt tcgccgccat ggtcgttcgc tggcaaagca atctcgccca catcgacatg       180
     gcctatgagc cggtcacgcc gccgccgcat gtcttcgctg cgatcgagag tagagttttc       240
     gagagcccgg cgagccccaa gaagtctgcc ggcctctgga actcgctgtc gttctggcgc       300
     agtctggcca ttgcctcgct tgccgccgtc gccgtcctcg ggatctccat gctcgagctt       360
     ttcagcgccg gtcagggcgg caagccgctt gtcgcggaac ttcaggggca aggcaacggc       420
     ctcggcctcg ccctcgttgc acagttcgac atcggaaccg ggcggctgag ggtgacgccg       480
     gtcgctgccc ggcaggccga ggagaaatcc ctggaactct ggctgatcaa gggcagcgac       540
     cccgccatct cgctcggcgt gctgccgcag tccggtgagg gcgagatccg cgtttcgccg       600
     gctgtccgct cgaagatcac cgaaggctcg acgctcgccg tcagcctcga gcctttaggc       660
     ggctcgccga ccggcgcggc caccggcccc gtcatcgcac tcggcacgac ccgccggtga       720
//

If you have problems or comments...

PBIL Back to PBIL home page