(data stored in ACNUC7421 zone)

EMBL: CP001389.PE77

CP001389.PE77        Location/Qualifiers
FT   CDS_pept        83058..83615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00770"
FT                   /product="conserved hypothetical protein contains
FT                   beta-Ig-H3/fasciclin domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00770"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23881"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF44"
FT                   /protein_id="ACP23881.1"
FT                   /translation="MFRSVFHSAALASILAVGATVAHAENPMVGGAPMYAEKNIVENAV
FT                   NSKDHTTLVAAVKAAGLVETLQGKGPFTVFAPTDDAFGALPTGTVDMLLKPENKDKLAK
FT                   VLTCHVVAADAMSSAIAKMIADDGGAHDVKTVGGCILKARSDGGKIGLTDETGSTAWVT
FT                   IADVKQSNGVIHVINKVLLPKG"
     atgttcaggt ccgtgttcca ttcggcggct ctcgcctcga ttcttgccgt cggcgctacc        60
     gtcgctcatg cggaaaaccc gatggtcggc ggcgcgccga tgtatgccga aaagaatatc       120
     gtcgagaatg ccgtcaactc gaaggaccac accacgctgg tcgcggccgt gaaagcggcc       180
     ggccttgtcg agacattgca gggcaagggt ccgttcacgg tcttcgcgcc caccgatgat       240
     gcgttcggtg ctttgccgac cgggacggtc gacatgctgt tgaaacccga gaacaaggac       300
     aagctcgcca aggtcctgac ctgccacgtc gtggcggccg atgcgatgtc gtcggcgatc       360
     gccaaaatga tcgccgatga tggcggcgcg cacgacgtca agacggtcgg aggctgcatc       420
     ctgaaagcca ggtccgacgg cggcaagatc ggcctgaccg atgagaccgg cagtaccgcc       480
     tgggtcacca ttgccgacgt gaagcagtcg aacggagtga tccacgtgat caacaaggtc       540
     ctgctgccga aaggctga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page