(data stored in ACNUC7421 zone)

EMBL: CP001389.PE79

CP001389.PE79        Location/Qualifiers
FT   CDS_pept        complement(84393..84932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00790"
FT                   /product="putative membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23883"
FT                   /db_xref="InterPro:IPR009200"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF46"
FT                   /protein_id="ACP23883.1"
FT                   /translation="MSDLIVIGFDTPEEADRVLLKLHSLKKEYLIDLEDAVVVVRDTDG
FT                   KVHLKQSINLPTVGAASGLLSGSLWGGLVGLLFLNPLAGFAIGGAIGAGAGALSGSLAD
FT                   YGIDDDFIKSLGSTIPNNSSALFILVRKVQPEKVLAELSGLRGRVLKTSLSPEQEHKLQ
FT                   AALSDAQTPSPPAGTF"
     atgtccgact tgattgtcat cggtttcgac acgccggagg aggccgaccg ggttctcctg        60
     aagctccaca gcctgaagaa ggaatatctg atcgatctgg aagacgcggt ggtcgtggtg       120
     cgcgacaccg acggcaaggt gcatctgaaa cagagtatca atctccccac ggtcggtgcc       180
     gcctccggcc tcctgtcagg ctcgctctgg ggcgggctgg tagggttgct tttcctgaac       240
     ccgctcgcgg gcttcgcgat cggcggtgcg atcggcgcgg gtgccggagc gctatccggc       300
     tcgcttgccg actacggcat cgacgacgat ttcatcaagt cgctcggcag cacgatcccg       360
     aacaactcct ccgccctttt catcctggtg cgcaaggtgc agcctgaaaa ggttctggcc       420
     gaactttcgg ggctccgcgg ccgcgtgctg aagacctcgc tctcaccgga gcaggagcac       480
     aagctgcagg ctgccctctc cgatgcacaa acaccgtcgc cacccgccgg gacgttttaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page