(data stored in ACNUC7421 zone)

EMBL: CP001389.PE8

CP001389.PE8         Location/Qualifiers
FT   CDS_pept        complement(7071..7715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00080"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23812"
FT                   /db_xref="GOA:C3MEI9"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI9"
FT                   /protein_id="ACP23812.1"
FT                   /translation="MRKLVDKTLVVASHNAGKIREIRDLIGPLGFEAKSAADLNFVEPD
FT                   ETGTTFEENATIKALASARASGLPALSDDSGLAIDALGGAPGVYTANWAERDDGSRDFA
FT                   MAMEKVERELSEKGATKPEERTARFVSVLCLAWPDGHVELFRGEVEGHVVWPPRGTSGF
FT                   GYDPVFQPTGYDTTFGEMSAEEKHGWKPGNSEALSHRARAFKLFAETCLGA"
     atgcgcaaac tcgttgacaa gacgctcgtg gtcgcgagcc acaatgccgg caagatccgc        60
     gaaatccgcg acttgatcgg gccgctcggc ttcgaagcca aatcagcggc cgatctcaat       120
     ttcgtcgagc cggacgagac cggcacgacc ttcgaggaaa acgcgacgat caaggcgctc       180
     gcctcggcca gggcctcggg tctgccggcc ctttcggacg attccggcct tgccatcgat       240
     gcgctcggcg gggcgccagg cgtctacacg gcaaactggg cggagcgcga cgacggcagc       300
     cgcgacttcg ccatggcgat ggaaaaggtc gaaagagagc tgagcgagaa gggcgcgacg       360
     aagccggaag agcggacggc gcgtttcgtc tcggtgctct gccttgcctg gccggatgga       420
     catgtcgagc tctttcgcgg cgaggtcgag ggccatgtcg tatggccgcc gcgcggaacc       480
     agcggcttcg gctacgatcc ggtcttccaa cccacgggct acgacaccac attcggcgag       540
     atgagcgcgg aagagaagca cggctggaag ccgggcaaca gcgaagccct gtcgcatcgc       600
     gcccgcgcct tcaagctgtt tgccgagacc tgcctcggcg cctga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page