(data stored in ACNUC7421 zone)

EMBL: CP001389.PE80

CP001389.PE80        Location/Qualifiers
FT   CDS_pept        complement(85072..85725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00800"
FT                   /product="predicted GTP-binding protein EngB-related"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23884"
FT                   /db_xref="GOA:C3MF47"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF47"
FT                   /protein_id="ACP23884.1"
FT                   /translation="MAETTTKDDKPLFGRPWIFIRGVPSMKFLPPEGPAEIAFAGRSNV
FT                   GKSSLINALVGHKGLARTSNTPGRTQELNYFVPDGYSGEADDLPPMALVDMPGYGYAQA
FT                   PKEQVDAWTKLVFDYLRGRSTLKRVYVLIDARHGIKKNDEEVLALLDKAAVSYQIVLTK
FT                   TDKIKAAGVPRLIAETLDKIKKRPAAYPEVLSTSSEKGAGIEDLRITIEQAVAR"
     atggccgaaa ccaccacaaa agacgacaag ccgctgttcg gccggccgtg gatcttcatc        60
     cgcggcgtcc cgtcgatgaa gttcctgccg cccgagggtc cggccgagat cgcctttgcc       120
     gggcgctcca atgtcggcaa gtcctcgctg atcaatgcgc tcgtcggcca caagggcctc       180
     gcccgcacct ccaacacgcc cgggcgcacc caggaactca actatttcgt gccggacggc       240
     tattccggcg aggccgatga cctaccgccg atggcgctcg tcgacatgcc cggctacggc       300
     tatgcccagg cgccgaagga acaggtggat gcctggacga agctggtctt cgactatctg       360
     cgcggccgct cgacactgaa gcgcgtctat gtgctgatcg acgcccgcca cggcatcaag       420
     aagaacgacg aggaggtgct ggcgcttctc gacaaggcgg cggtctccta ccagatcgtg       480
     ctcaccaaga ccgacaagat caaggcggcc ggcgtgccca ggctgatcgc cgagacgctc       540
     gacaagatca agaagcggcc ggccgcctat ccggaggtcc tatcgacatc ttcggaaaag       600
     ggcgccggga tcgaagacct tcgcatcacg atcgaacagg cggtcgcgcg ctga             654
//

If you have problems or comments...

PBIL Back to PBIL home page