(data stored in ACNUC7421 zone)

EMBL: CP001389.PE81

CP001389.PE81        Location/Qualifiers
FT   CDS_pept        complement(85782..86714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00810"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00810"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23885"
FT                   /db_xref="GOA:C3MF48"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF48"
FT                   /protein_id="ACP23885.1"
FT                   /translation="MTDPSATSASFGANEKFGTLLVFGSAFFWSFGGAIARFLHISDSW
FT                   TIVFWRCLFAGLFLLAFMLVRDGPRGTVSLVRGMGWPGVAVGLCFTTASTSFIIAISYT
FT                   TIANVVLLGAGVPLFAALMSWVLFRERVSRFTWGAIAAVIFGVAIMVSESLNGSVSPVG
FT                   DALALLIPVVFALATVITRRYPHVRMTPATCFGCFAASAIAASQSSDLSVTPGELALLF
FT                   AFGAFNLGLGMALFVTGARLVPSALAALLGTAETVLAPVWVAIIHGEVPSGRTIVGGVF
FT                   IFLALLAYLFNEFRGQRNGPRRPVRTPTP"
     atgacggacc cgtcggccac ctccgcctcg ttcggcgcca acgaaaaatt tggcaccctg        60
     ctcgtcttcg gctcggcctt cttctggagc ttcggcggcg ccatcgcgcg cttcctgcat       120
     atttccgaca gctggacgat cgtcttctgg cgctgcctgt ttgccggtct cttcctgctg       180
     gcgttcatgc tcgttcgtga cggaccgcgc ggcaccgtgt cgctcgtcag gggcatgggc       240
     tggccgggcg ttgccgtcgg actctgcttc accaccgcct cgacctcctt catcattgcc       300
     atttcctaca cgacgatcgc caatgtcgtt ctgctcgggg ccggagtgcc cctgttcgcc       360
     gcgctgatga gctgggtgct gtttcgtgaa cgggtttcgc gtttcacctg gggtgcgatc       420
     gccgccgtga tcttcggggt ggcgatcatg gtgtcggaga gtctgaacgg gtcggtctcg       480
     ccggtcggcg atgcgctcgc gctgcttatc cccgtcgtct tcgcgcttgc aaccgtgatc       540
     acccgccgct acccgcatgt gcggatgacc ccggcgacct gcttcggctg ctttgccgcc       600
     agcgccattg ccgcaagcca gtcgtccgac ctttcggtga cgccgggcga actcgccctg       660
     ctcttcgcct tcggcgcctt caatctcggg cttggcatgg cgctcttcgt cactggcgcc       720
     cggctggtgc cgtcggcgct tgccgcactg cttggcacgg ccgaaaccgt gctcgccccc       780
     gtctgggttg ccatcattca cggcgaggtg ccgagtggcc gcacgatcgt cggcggcgtc       840
     ttcatcttcc tggcgctgct tgcctatctc ttcaatgagt tccggggcca gcggaacggc       900
     cccaggcggc cagttcggac gccgacacct tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page