(data stored in ACNUC7421 zone)

EMBL: CP001389.PE82

CP001389.PE82        Location/Qualifiers
FT   CDS_pept        complement(86963..88741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00820"
FT                   /product="putative inner membrane protein translocase
FT                   component YidC"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00820"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23886"
FT                   /db_xref="GOA:C3MF49"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF49"
FT                   /protein_id="ACP23886.1"
FT                   /translation="MMENNRNYFVAIALSVLILVAWQYFYVNPRMDKDRIAAEKAQQTQ
FT                   QVQPQQGGQQPAPGQALPGGAVPGESRDQAVAKSARVAIDTPALSGSINLTGARFDDLK
FT                   LKGYHETVDPKSPVITLFSPAETADGYFTEIGYIGNDASGSVPGPQTVWTLSGGEKLTP
FT                   ATPVTLTYTNDKGITFARTISIDENYMFQVVDSIKNDGSAPVSLSSYGRVTRFNKPTTP
FT                   SIYVLHEGFIGVAGGSLQEVGYSKIEENLPVEPGKTTGGWHGITDKYWAAAIVPPQETP
FT                   FDIRFSHFTDGRPRFQSDYKGDAVTVAPGQSAEVKNLVFAGAKEVQVVDTYTTAYAIPK
FT                   FEKLIDWGWFWFITQPMFKMMDFFFRLFGNFGVAILVTTIVVKLIFFPLANKQYASMAN
FT                   MKKVQPKMEELKKKFGDDRMGLQQAMMQLYKDEKINPLAGCWPILIQIPVFFALYKVIY
FT                   ITIEMRHAPFFGWIRDLSAPDPTTIVNLFGLLPFDGPAFLHLGIWPIIMGVTMFLQMRM
FT                   NPTPPDPTQAMLFTWMPLVFTFMLASFPAGLVIYWAWNNTLSITQQSIIMKRQGVKIEL
FT                   FDNLKGLFTKRPKPAE"
     atgatggaaa acaatcgcaa ttatttcgtg gcgatagcgc tctcggtgct gatcctcgtt        60
     gcttggcaat acttctatgt caatcccagg atggataagg accggatcgc tgcggaaaaa       120
     gcccagcaga cacagcaggt gcagccgcag cagggaggcc agcagcccgc accgggccag       180
     gcacttcccg gtggcgccgt tcccggcgaa agccgtgacc aggcggtcgc caagtctgca       240
     cgcgtcgcga tcgacacgcc ggcgctgtcc ggttccatca acctgaccgg cgcacgcttc       300
     gacgacctga agctcaaggg ctaccacgag accgtcgacc cgaagagccc ggtcatcacc       360
     ctcttcagcc cggcggaaac cgcggacggc tatttcaccg aaatcggcta tatcggtaac       420
     gacgcgagcg gctccgtacc tggcccgcag accgtctgga cactctccgg cggcgagaag       480
     ctgacgccgg caacgcccgt taccctcacc tacacgaacg acaagggcat caccttcgcc       540
     cggacgatct cgatcgacga gaactacatg ttccaggtcg tcgacagcat caagaatgac       600
     ggctccgcgc cggtttcgct ttcctcctat ggtcgcgtga cgcgcttcaa caagccgacg       660
     acgccgagca tctacgtgct gcacgagggc ttcatcggcg tcgccggcgg cagcctgcag       720
     gaggtcggct attcgaaaat agaagaaaac ctgccggttg aacccggcaa aacgaccggc       780
     ggctggcatg gtatcaccga caaatactgg gcagcggcta tcgtcccgcc gcaggagacg       840
     cccttcgaca tccgcttctc gcacttcacc gatggccgcc cccgtttcca gagcgactac       900
     aagggcgatg cggtcaccgt cgcgcccggc cagtccgcgg aggtcaagaa cctcgtcttc       960
     gccggcgcca aggaagtcca ggttgtcgac acctacacga ccgcttacgc cattccaaag      1020
     ttcgagaagc tgatcgactg gggttggttc tggttcatca cccagccgat gttcaagatg      1080
     atggatttct tcttccgtct gttcggcaat ttcggcgtcg cgatcctggt caccacgatc      1140
     gtcgtcaagc tgatcttctt cccgctcgcc aacaagcaat atgcctcgat ggcgaacatg      1200
     aagaaggtcc agccgaagat ggaggagctg aagaagaagt tcggcgacga ccgcatgggg      1260
     ctgcagcagg cgatgatgca gctctacaag gacgagaaga tcaatccgct ggcgggctgc      1320
     tggccgatcc tcatccagat tccggtgttc ttcgcactct acaaggtgat ctacatcacc      1380
     atcgagatgc gccatgcacc gttcttcggc tggatcaggg atctttccgc tcccgacccg      1440
     acgacgatcg tcaacctctt cggcctgctg cccttcgacg ggccggcctt cctgcatctc      1500
     ggcatctggc cgatcatcat gggcgtcacc atgttccttc agatgcgcat gaacccgacg      1560
     ccgccggacc cgacccaggc aatgctgttc acctggatgc cgctggtctt caccttcatg      1620
     ctggcgtcct tcccggccgg cctggtgatc tactgggcct ggaacaacac cctgtcgatc      1680
     acccagcagt cgatcatcat gaagcggcag ggcgtgaaga tcgagctctt cgacaatctg      1740
     aaggggctgt tcacgaagag accgaagccg gcggaatag                             1779
//

If you have problems or comments...

PBIL Back to PBIL home page