(data stored in ACNUC7421 zone)

EMBL: CP001389.PE84

CP001389.PE84        Location/Qualifiers
FT   CDS_pept        complement(89157..89291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00840"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00840"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23888"
FT                   /db_xref="GOA:C3MF51"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF51"
FT                   /protein_id="ACP23888.1"
FT                   /translation="MKRTYQPSKLVRKRRHGFRARMSTKGGQKVLAARRARGRKRLSA"
     atgaagcgta cctaccaacc gtccaagctt gttcgcaagc gccgtcacgg cttccgtgcc        60
     cgcatgtcca ccaagggtgg ccagaaggtc ctcgcagccc gccgggctcg tggccgcaag       120
     cgtctctcgg cttga                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page